Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4963741..4964357 | Replicon | chromosome |
Accession | NZ_CP099382 | ||
Organism | Citrobacter braakii strain RHB14-SO-C08 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A2I8SCX0 |
Locus tag | NFJ83_RS23775 | Protein ID | WP_049269424.1 |
Coordinates | 4963741..4964115 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | R8WIS4 |
Locus tag | NFJ83_RS23780 | Protein ID | WP_016155181.1 |
Coordinates | 4964115..4964357 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ83_RS23760 (4961244) | 4961244..4962146 | + | 903 | WP_003028691.1 | formate dehydrogenase O subunit beta | - |
NFJ83_RS23765 (4962143) | 4962143..4962778 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
NFJ83_RS23770 (4962775) | 4962775..4963704 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
NFJ83_RS23775 (4963741) | 4963741..4964115 | - | 375 | WP_049269424.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NFJ83_RS23780 (4964115) | 4964115..4964357 | - | 243 | WP_016155181.1 | CopG family transcriptional regulator | Antitoxin |
NFJ83_RS23785 (4964563) | 4964563..4965471 | + | 909 | WP_049269423.1 | alpha/beta hydrolase | - |
NFJ83_RS23790 (4965536) | 4965536..4965778 | + | 243 | WP_016155179.1 | type II toxin-antitoxin system ParD family antitoxin | - |
NFJ83_RS23795 (4965771) | 4965771..4966058 | + | 288 | WP_049269420.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
NFJ83_RS23800 (4966064) | 4966064..4967005 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
NFJ83_RS23805 (4967050) | 4967050..4967487 | - | 438 | WP_003028671.1 | D-aminoacyl-tRNA deacylase | - |
NFJ83_RS23810 (4967484) | 4967484..4968356 | - | 873 | WP_019077938.1 | virulence factor BrkB family protein | - |
NFJ83_RS23815 (4968350) | 4968350..4968879 | - | 530 | Protein_4656 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13650.78 Da Isoelectric Point: 8.5373
>T248784 WP_049269424.1 NZ_CP099382:c4964115-4963741 [Citrobacter braakii]
MATGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL
MATGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2I8SCX0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | R8WIS4 |