Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-DnaT |
Location | 4535991..4536510 | Replicon | chromosome |
Accession | NZ_CP099382 | ||
Organism | Citrobacter braakii strain RHB14-SO-C08 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NFJ83_RS21800 | Protein ID | WP_019078244.1 |
Coordinates | 4535991..4536272 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NFJ83_RS21805 | Protein ID | WP_103283421.1 |
Coordinates | 4536262..4536510 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ83_RS21785 (4532992) | 4532992..4533456 | + | 465 | WP_016151476.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NFJ83_RS21790 (4533478) | 4533478..4533999 | - | 522 | WP_049270665.1 | hypothetical protein | - |
NFJ83_RS21795 (4533999) | 4533999..4535963 | - | 1965 | WP_279265956.1 | type VI secretion system tip protein TssI/VgrG | - |
NFJ83_RS21800 (4535991) | 4535991..4536272 | - | 282 | WP_019078244.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFJ83_RS21805 (4536262) | 4536262..4536510 | - | 249 | WP_103283421.1 | plasmid stabilization protein | Antitoxin |
NFJ83_RS21810 (4536608) | 4536608..4536736 | - | 129 | WP_016155557.1 | hypothetical protein | - |
NFJ83_RS21815 (4536805) | 4536805..4537278 | - | 474 | WP_016155556.1 | hypothetical protein | - |
NFJ83_RS21820 (4537321) | 4537321..4539822 | - | 2502 | WP_279265957.1 | type VI secretion system ATPase TssH | - |
NFJ83_RS21825 (4539813) | 4539813..4540760 | - | 948 | WP_103284439.1 | type VI secretion system baseplate subunit TssG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10988.76 Da Isoelectric Point: 10.4466
>T248783 WP_019078244.1 NZ_CP099382:c4536272-4535991 [Citrobacter braakii]
MTYNLEFLDIALKEWRKLSPALREQFKKKLAERLENPHVPAARLSGKLHRYKIKLRSAGYRLVYQVEDEQVVVLVIAVGR
RDGDEVYHQANRR
MTYNLEFLDIALKEWRKLSPALREQFKKKLAERLENPHVPAARLSGKLHRYKIKLRSAGYRLVYQVEDEQVVVLVIAVGR
RDGDEVYHQANRR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|