Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4383200..4383776 | Replicon | chromosome |
Accession | NZ_CP099382 | ||
Organism | Citrobacter braakii strain RHB14-SO-C08 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | A0A2I8S420 |
Locus tag | NFJ83_RS21085 | Protein ID | WP_049269953.1 |
Coordinates | 4383489..4383776 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A2I8S1U6 |
Locus tag | NFJ83_RS21080 | Protein ID | WP_016155614.1 |
Coordinates | 4383200..4383502 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ83_RS21065 (4379695) | 4379695..4379889 | + | 195 | WP_003830038.1 | YbdD/YjiX family protein | - |
NFJ83_RS21070 (4379902) | 4379902..4380858 | + | 957 | WP_049040419.1 | GTPase | - |
NFJ83_RS21075 (4381045) | 4381045..4382892 | + | 1848 | WP_101700343.1 | 3'-5' exonuclease | - |
NFJ83_RS21080 (4383200) | 4383200..4383502 | - | 303 | WP_016155614.1 | BrnA antitoxin family protein | Antitoxin |
NFJ83_RS21085 (4383489) | 4383489..4383776 | - | 288 | WP_049269953.1 | BrnT family toxin | Toxin |
NFJ83_RS21090 (4384008) | 4384008..4385174 | + | 1167 | WP_279265941.1 | restriction endonuclease | - |
NFJ83_RS21095 (4385270) | 4385270..4385425 | + | 156 | Protein_4133 | type I restriction endonuclease subunit R | - |
NFJ83_RS21100 (4385406) | 4385406..4385638 | + | 233 | Protein_4134 | SymE family type I addiction module toxin | - |
NFJ83_RS21105 (4385769) | 4385769..4386260 | - | 492 | WP_016151575.1 | type VI secretion system tube protein TssD | - |
NFJ83_RS21110 (4386261) | 4386261..4386767 | - | 507 | WP_047414535.1 | hypothetical protein | - |
NFJ83_RS21115 (4386767) | 4386767..4387198 | - | 432 | WP_233896696.1 | DUF2778 domain-containing protein | - |
NFJ83_RS21120 (4387404) | 4387404..4388468 | - | 1065 | WP_049041982.1 | DUF2955 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11433.87 Da Isoelectric Point: 8.6051
>T248782 WP_049269953.1 NZ_CP099382:c4383776-4383489 [Citrobacter braakii]
MPMEFEWDANKAQSNHRKHGVRFEDAILVFDDPQHLSRQERYENGEYRWQTIGLVHGIVVILVAHSVRFESRFEVIRIIS
ARKADRKERNRYEHS
MPMEFEWDANKAQSNHRKHGVRFEDAILVFDDPQHLSRQERYENGEYRWQTIGLVHGIVVILVAHSVRFESRFEVIRIIS
ARKADRKERNRYEHS
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2I8S420 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2I8S1U6 |