Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3803046..3803666 | Replicon | chromosome |
Accession | NZ_CP099382 | ||
Organism | Citrobacter braakii strain RHB14-SO-C08 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | NFJ83_RS18420 | Protein ID | WP_002892050.1 |
Coordinates | 3803448..3803666 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | R8WZW8 |
Locus tag | NFJ83_RS18415 | Protein ID | WP_003021733.1 |
Coordinates | 3803046..3803420 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ83_RS18405 (3798193) | 3798193..3799386 | + | 1194 | WP_016152074.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NFJ83_RS18410 (3799409) | 3799409..3802558 | + | 3150 | WP_016152073.1 | efflux RND transporter permease AcrB | - |
NFJ83_RS18415 (3803046) | 3803046..3803420 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
NFJ83_RS18420 (3803448) | 3803448..3803666 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
NFJ83_RS18425 (3803847) | 3803847..3804398 | + | 552 | WP_103283555.1 | maltose O-acetyltransferase | - |
NFJ83_RS18430 (3804515) | 3804515..3804985 | + | 471 | WP_016152071.1 | YlaC family protein | - |
NFJ83_RS18435 (3805063) | 3805063..3805203 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
NFJ83_RS18440 (3805205) | 3805205..3805465 | - | 261 | WP_016152070.1 | type B 50S ribosomal protein L31 | - |
NFJ83_RS18445 (3805654) | 3805654..3807207 | + | 1554 | WP_047416867.1 | EAL domain-containing protein | - |
NFJ83_RS18450 (3807259) | 3807259..3807612 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
NFJ83_RS18455 (3807677) | 3807677..3808306 | - | 630 | WP_103283554.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T248781 WP_002892050.1 NZ_CP099382:3803448-3803666 [Citrobacter braakii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT248781 WP_003021733.1 NZ_CP099382:3803046-3803420 [Citrobacter braakii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | R8WZW8 |