Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2459457..2460093 | Replicon | chromosome |
| Accession | NZ_CP099382 | ||
| Organism | Citrobacter braakii strain RHB14-SO-C08 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2I8S6E9 |
| Locus tag | NFJ83_RS11920 | Protein ID | WP_049259794.1 |
| Coordinates | 2459457..2459645 (+) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NFJ83_RS11925 | Protein ID | WP_146053235.1 |
| Coordinates | 2459677..2460093 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ83_RS11900 (2456235) | 2456235..2456465 | - | 231 | WP_016156585.1 | DUF2554 family protein | - |
| NFJ83_RS11905 (2456655) | 2456655..2456780 | - | 126 | WP_003020230.1 | DUF2474 domain-containing protein | - |
| NFJ83_RS11910 (2456780) | 2456780..2457790 | - | 1011 | WP_016153157.1 | cytochrome d ubiquinol oxidase subunit II | - |
| NFJ83_RS11915 (2457790) | 2457790..2459193 | - | 1404 | WP_016153156.1 | cytochrome ubiquinol oxidase subunit I | - |
| NFJ83_RS11920 (2459457) | 2459457..2459645 | + | 189 | WP_049259794.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NFJ83_RS11925 (2459677) | 2459677..2460093 | + | 417 | WP_146053235.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NFJ83_RS11930 (2460186) | 2460186..2461595 | + | 1410 | WP_103283798.1 | PLP-dependent aminotransferase family protein | - |
| NFJ83_RS11935 (2461925) | 2461925..2463070 | + | 1146 | WP_016153154.1 | ABC transporter substrate-binding protein | - |
| NFJ83_RS11940 (2463087) | 2463087..2464103 | + | 1017 | WP_016153153.1 | ABC transporter ATP-binding protein | - |
| NFJ83_RS11945 (2464104) | 2464104..2465048 | + | 945 | WP_016153152.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7102.16 Da Isoelectric Point: 11.5775
>T248775 WP_049259794.1 NZ_CP099382:2459457-2459645 [Citrobacter braakii]
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
Download Length: 189 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15080.33 Da Isoelectric Point: 4.7119
>AT248775 WP_146053235.1 NZ_CP099382:2459677-2460093 [Citrobacter braakii]
MRYPVNLIPSVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGTEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
MRYPVNLIPSVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGTEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|