Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 876684..877338 | Replicon | chromosome |
Accession | NZ_CP099382 | ||
Organism | Citrobacter braakii strain RHB14-SO-C08 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | R8WN60 |
Locus tag | NFJ83_RS04315 | Protein ID | WP_016154348.1 |
Coordinates | 876931..877338 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | R8WMJ6 |
Locus tag | NFJ83_RS04310 | Protein ID | WP_016154349.1 |
Coordinates | 876684..876950 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ83_RS04285 (871897) | 871897..873330 | - | 1434 | WP_016154353.1 | 6-phospho-beta-glucosidase BglA | - |
NFJ83_RS04290 (873451) | 873451..874179 | - | 729 | WP_103284472.1 | MurR/RpiR family transcriptional regulator | - |
NFJ83_RS04295 (874232) | 874232..874543 | + | 312 | WP_016154352.1 | N(4)-acetylcytidine aminohydrolase | - |
NFJ83_RS04300 (874707) | 874707..875366 | + | 660 | WP_016154351.1 | hemolysin III family protein | - |
NFJ83_RS04305 (875446) | 875446..876426 | - | 981 | WP_016154350.1 | tRNA-modifying protein YgfZ | - |
NFJ83_RS04310 (876684) | 876684..876950 | + | 267 | WP_016154349.1 | FAD assembly factor SdhE | Antitoxin |
NFJ83_RS04315 (876931) | 876931..877338 | + | 408 | WP_016154348.1 | protein YgfX | Toxin |
NFJ83_RS04320 (877439) | 877439..877960 | - | 522 | WP_016154347.1 | flavodoxin FldB | - |
NFJ83_RS04325 (878074) | 878074..878970 | + | 897 | WP_016154346.1 | site-specific tyrosine recombinase XerD | - |
NFJ83_RS04330 (878994) | 878994..879707 | + | 714 | WP_075847456.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFJ83_RS04335 (879713) | 879713..881446 | + | 1734 | WP_103284192.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15850.66 Da Isoelectric Point: 11.2845
>T248774 WP_016154348.1 NZ_CP099382:876931-877338 [Citrobacter braakii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|