Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4858701..4859317 | Replicon | chromosome |
| Accession | NZ_CP099381 | ||
| Organism | Citrobacter braakii strain RHB16-E2-C02 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NFJ84_RS23315 | Protein ID | WP_047497510.1 |
| Coordinates | 4858701..4859075 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | R8WIS4 |
| Locus tag | NFJ84_RS23320 | Protein ID | WP_016155181.1 |
| Coordinates | 4859075..4859317 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ84_RS23300 (NFJ84_23285) | 4856204..4857106 | + | 903 | WP_257679917.1 | formate dehydrogenase O subunit beta | - |
| NFJ84_RS23305 (NFJ84_23290) | 4857103..4857738 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NFJ84_RS23310 (NFJ84_23295) | 4857735..4858664 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
| NFJ84_RS23315 (NFJ84_23300) | 4858701..4859075 | - | 375 | WP_047497510.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NFJ84_RS23320 (NFJ84_23305) | 4859075..4859317 | - | 243 | WP_016155181.1 | CopG family transcriptional regulator | Antitoxin |
| NFJ84_RS23325 (NFJ84_23310) | 4859522..4860451 | + | 930 | WP_279265388.1 | alpha/beta hydrolase | - |
| NFJ84_RS23330 (NFJ84_23315) | 4860536..4860847 | + | 312 | WP_279265389.1 | type II toxin-antitoxin system HigB family toxin | - |
| NFJ84_RS23335 (NFJ84_23320) | 4860844..4861296 | + | 453 | WP_080859878.1 | helix-turn-helix domain-containing protein | - |
| NFJ84_RS23340 (NFJ84_23325) | 4861314..4862255 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
| NFJ84_RS23345 (NFJ84_23330) | 4862300..4862737 | - | 438 | WP_003028671.1 | D-aminoacyl-tRNA deacylase | - |
| NFJ84_RS23350 (NFJ84_23335) | 4862734..4863606 | - | 873 | WP_019077938.1 | virulence factor BrkB family protein | - |
| NFJ84_RS23355 (NFJ84_23340) | 4863600..4864199 | - | 600 | WP_016155174.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13692.86 Da Isoelectric Point: 8.5374
>T248772 WP_047497510.1 NZ_CP099381:c4859075-4858701 [Citrobacter braakii]
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQEIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQEIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|