Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4858701..4859317 Replicon chromosome
Accession NZ_CP099381
Organism Citrobacter braakii strain RHB16-E2-C02

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NFJ84_RS23315 Protein ID WP_047497510.1
Coordinates 4858701..4859075 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID R8WIS4
Locus tag NFJ84_RS23320 Protein ID WP_016155181.1
Coordinates 4859075..4859317 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFJ84_RS23300 (NFJ84_23285) 4856204..4857106 + 903 WP_257679917.1 formate dehydrogenase O subunit beta -
NFJ84_RS23305 (NFJ84_23290) 4857103..4857738 + 636 WP_003028686.1 formate dehydrogenase cytochrome b556 subunit -
NFJ84_RS23310 (NFJ84_23295) 4857735..4858664 + 930 WP_003028685.1 formate dehydrogenase accessory protein FdhE -
NFJ84_RS23315 (NFJ84_23300) 4858701..4859075 - 375 WP_047497510.1 type II toxin-antitoxin system VapC family toxin Toxin
NFJ84_RS23320 (NFJ84_23305) 4859075..4859317 - 243 WP_016155181.1 CopG family transcriptional regulator Antitoxin
NFJ84_RS23325 (NFJ84_23310) 4859522..4860451 + 930 WP_279265388.1 alpha/beta hydrolase -
NFJ84_RS23330 (NFJ84_23315) 4860536..4860847 + 312 WP_279265389.1 type II toxin-antitoxin system HigB family toxin -
NFJ84_RS23335 (NFJ84_23320) 4860844..4861296 + 453 WP_080859878.1 helix-turn-helix domain-containing protein -
NFJ84_RS23340 (NFJ84_23325) 4861314..4862255 - 942 WP_003825286.1 fatty acid biosynthesis protein FabY -
NFJ84_RS23345 (NFJ84_23330) 4862300..4862737 - 438 WP_003028671.1 D-aminoacyl-tRNA deacylase -
NFJ84_RS23350 (NFJ84_23335) 4862734..4863606 - 873 WP_019077938.1 virulence factor BrkB family protein -
NFJ84_RS23355 (NFJ84_23340) 4863600..4864199 - 600 WP_016155174.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-113)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13692.86 Da        Isoelectric Point: 8.5374

>T248772 WP_047497510.1 NZ_CP099381:c4859075-4858701 [Citrobacter braakii]
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQEIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.72 Da        Isoelectric Point: 4.3331

>AT248772 WP_016155181.1 NZ_CP099381:c4859317-4859075 [Citrobacter braakii]
MMAGMDMGRILLDLSDEVIKRLDDLKVQRNLPRAELLREAVEQYLERQDQAETTISRALGLWQGCEEDGVDYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB R8WIS4

References