Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4362344..4363024 | Replicon | chromosome |
Accession | NZ_CP099381 | ||
Organism | Citrobacter braakii strain RHB16-E2-C02 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | NFJ84_RS21005 | Protein ID | WP_279265310.1 |
Coordinates | 4362344..4362664 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | NFJ84_RS21010 | Protein ID | WP_279265311.1 |
Coordinates | 4362701..4363024 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ84_RS20975 (NFJ84_20955) | 4357712..4358197 | - | 486 | WP_094760967.1 | type VI secretion system tube protein TssD | - |
NFJ84_RS20980 (NFJ84_20960) | 4358217..4358549 | - | 333 | WP_094760968.1 | DUF1493 family protein | - |
NFJ84_RS20985 (NFJ84_20965) | 4358543..4358998 | - | 456 | WP_235117079.1 | hypothetical protein | - |
NFJ84_RS20990 (NFJ84_20970) | 4359257..4360129 | + | 873 | WP_047500815.1 | HNH endonuclease | - |
NFJ84_RS20995 (NFJ84_20975) | 4360316..4361323 | - | 1008 | WP_279265308.1 | restriction endonuclease | - |
NFJ84_RS21000 (NFJ84_20980) | 4361400..4362230 | - | 831 | WP_279265309.1 | DUF4942 domain-containing protein | - |
NFJ84_RS21005 (NFJ84_20985) | 4362344..4362664 | - | 321 | WP_279265310.1 | TA system toxin CbtA family protein | Toxin |
NFJ84_RS21010 (NFJ84_20990) | 4362701..4363024 | - | 324 | WP_279265311.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NFJ84_RS21015 (NFJ84_20995) | 4363037..4363507 | - | 471 | WP_279265312.1 | DNA repair protein RadC | - |
NFJ84_RS21020 (NFJ84_21000) | 4363579..4364397 | - | 819 | WP_279265313.1 | DUF932 domain-containing protein | - |
NFJ84_RS21025 (NFJ84_21005) | 4364547..4365344 | - | 798 | WP_279265314.1 | hypothetical protein | - |
NFJ84_RS21030 (NFJ84_21010) | 4365788..4366672 | - | 885 | WP_279265315.1 | 50S ribosome-binding GTPase | - |
NFJ84_RS21035 (NFJ84_21015) | 4366871..4367725 | - | 855 | WP_279265316.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4358217..4376805 | 18588 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12011.68 Da Isoelectric Point: 6.3221
>T248771 WP_279265310.1 NZ_CP099381:c4362664-4362344 [Citrobacter braakii]
MHISSVPPTVPVSSRLSPVQVWKQLLTYLLEHHYGLTLNDTPFHDGAAIEDHIDAGITLADAVNFLVERYELVRIDRKGF
TWQEQTPFLTTTDILRARRATGLINT
MHISSVPPTVPVSSRLSPVQVWKQLLTYLLEHHYGLTLNDTPFHDGAAIEDHIDAGITLADAVNFLVERYELVRIDRKGF
TWQEQTPFLTTTDILRARRATGLINT
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|