Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 848006..848660 | Replicon | chromosome |
| Accession | NZ_CP099381 | ||
| Organism | Citrobacter braakii strain RHB16-E2-C02 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | R8WN60 |
| Locus tag | NFJ84_RS04095 | Protein ID | WP_016154348.1 |
| Coordinates | 848253..848660 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | R8WMJ6 |
| Locus tag | NFJ84_RS04090 | Protein ID | WP_016154349.1 |
| Coordinates | 848006..848272 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ84_RS04065 (NFJ84_04055) | 843219..844652 | - | 1434 | WP_016154353.1 | 6-phospho-beta-glucosidase BglA | - |
| NFJ84_RS04070 (NFJ84_04060) | 844773..845501 | - | 729 | WP_003838265.1 | MurR/RpiR family transcriptional regulator | - |
| NFJ84_RS04075 (NFJ84_04065) | 845554..845865 | + | 312 | WP_016154352.1 | N(4)-acetylcytidine aminohydrolase | - |
| NFJ84_RS04080 (NFJ84_04070) | 846029..846688 | + | 660 | WP_016154351.1 | hemolysin III family protein | - |
| NFJ84_RS04085 (NFJ84_04075) | 846768..847748 | - | 981 | WP_235117299.1 | tRNA-modifying protein YgfZ | - |
| NFJ84_RS04090 (NFJ84_04080) | 848006..848272 | + | 267 | WP_016154349.1 | FAD assembly factor SdhE | Antitoxin |
| NFJ84_RS04095 (NFJ84_04085) | 848253..848660 | + | 408 | WP_016154348.1 | protein YgfX | Toxin |
| NFJ84_RS04100 (NFJ84_04090) | 848761..849282 | - | 522 | WP_279265524.1 | flavodoxin FldB | - |
| NFJ84_RS04105 (NFJ84_04095) | 849396..850292 | + | 897 | WP_016154346.1 | site-specific tyrosine recombinase XerD | - |
| NFJ84_RS04110 (NFJ84_04100) | 850316..851029 | + | 714 | WP_103766660.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NFJ84_RS04115 (NFJ84_04105) | 851035..852768 | + | 1734 | WP_016157413.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15850.66 Da Isoelectric Point: 11.2845
>T248764 WP_016154348.1 NZ_CP099381:848253-848660 [Citrobacter braakii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|