Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4657617..4658233 Replicon chromosome
Accession NZ_CP099379
Organism Citrobacter braakii strain RHB16-SO-C07

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NFJ89_RS22140 Protein ID WP_016155182.1
Coordinates 4657617..4657991 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID R8WIS4
Locus tag NFJ89_RS22145 Protein ID WP_016155181.1
Coordinates 4657991..4658233 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFJ89_RS22125 (NFJ89_22130) 4655120..4656022 + 903 WP_003028691.1 formate dehydrogenase O subunit beta -
NFJ89_RS22130 (NFJ89_22135) 4656019..4656654 + 636 WP_003028686.1 formate dehydrogenase cytochrome b556 subunit -
NFJ89_RS22135 (NFJ89_22140) 4656651..4657580 + 930 WP_003028685.1 formate dehydrogenase accessory protein FdhE -
NFJ89_RS22140 (NFJ89_22145) 4657617..4657991 - 375 WP_016155182.1 type II toxin-antitoxin system VapC family toxin Toxin
NFJ89_RS22145 (NFJ89_22150) 4657991..4658233 - 243 WP_016155181.1 CopG family transcriptional regulator Antitoxin
NFJ89_RS22150 (NFJ89_22155) 4658439..4659368 + 930 WP_047357779.1 alpha/beta hydrolase -
NFJ89_RS22155 (NFJ89_22160) 4659453..4659764 + 312 WP_047357780.1 type II toxin-antitoxin system HigB family toxin -
NFJ89_RS22160 (NFJ89_22165) 4659761..4660213 + 453 WP_047357781.1 helix-turn-helix domain-containing protein -
NFJ89_RS22165 (NFJ89_22170) 4660231..4661172 - 942 WP_003825286.1 fatty acid biosynthesis protein FabY -
NFJ89_RS22170 (NFJ89_22175) 4661217..4661654 - 438 WP_016157874.1 D-aminoacyl-tRNA deacylase -
NFJ89_RS22175 (NFJ89_22180) 4661651..4662523 - 873 WP_019077938.1 virulence factor BrkB family protein -
NFJ89_RS22180 (NFJ89_22185) 4662517..4663116 - 600 WP_016157873.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-113)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13678.84 Da        Isoelectric Point: 8.5373

>T248761 WP_016155182.1 NZ_CP099379:c4657991-4657617 [Citrobacter braakii]
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.72 Da        Isoelectric Point: 4.3331

>AT248761 WP_016155181.1 NZ_CP099379:c4658233-4657991 [Citrobacter braakii]
MMAGMDMGRILLDLSDEVIKRLDDLKVQRNLPRAELLREAVEQYLERQDQAETTISRALGLWQGCEEDGVDYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB R8WIS4

References