Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3528593..3529213 | Replicon | chromosome |
Accession | NZ_CP099379 | ||
Organism | Citrobacter braakii strain RHB16-SO-C07 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | NFJ89_RS16925 | Protein ID | WP_002892050.1 |
Coordinates | 3528995..3529213 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | R8WZW8 |
Locus tag | NFJ89_RS16920 | Protein ID | WP_003021733.1 |
Coordinates | 3528593..3528967 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ89_RS16910 (NFJ89_16910) | 3523740..3524933 | + | 1194 | WP_016152074.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NFJ89_RS16915 (NFJ89_16915) | 3524956..3528105 | + | 3150 | WP_016152073.1 | efflux RND transporter permease AcrB | - |
NFJ89_RS16920 (NFJ89_16920) | 3528593..3528967 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
NFJ89_RS16925 (NFJ89_16925) | 3528995..3529213 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
NFJ89_RS16930 (NFJ89_16930) | 3529394..3529945 | + | 552 | WP_016152072.1 | maltose O-acetyltransferase | - |
NFJ89_RS16935 (NFJ89_16935) | 3530062..3530532 | + | 471 | WP_016152071.1 | YlaC family protein | - |
NFJ89_RS16940 (NFJ89_16940) | 3530611..3530751 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
NFJ89_RS16945 (NFJ89_16945) | 3530753..3531013 | - | 261 | WP_016152070.1 | type B 50S ribosomal protein L31 | - |
NFJ89_RS16950 (NFJ89_16950) | 3531202..3532755 | + | 1554 | WP_047358017.1 | EAL domain-containing protein | - |
NFJ89_RS16955 (NFJ89_16955) | 3532807..3533160 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
NFJ89_RS16960 (NFJ89_16960) | 3533225..3533854 | - | 630 | WP_016155872.1 | membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T248758 WP_002892050.1 NZ_CP099379:3528995-3529213 [Citrobacter braakii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT248758 WP_003021733.1 NZ_CP099379:3528593-3528967 [Citrobacter braakii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | R8WZW8 |