Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2299738..2300374 | Replicon | chromosome |
| Accession | NZ_CP099379 | ||
| Organism | Citrobacter braakii strain RHB16-SO-C07 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2I8S6E9 |
| Locus tag | NFJ89_RS10960 | Protein ID | WP_049259794.1 |
| Coordinates | 2299738..2299926 (+) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NFJ89_RS10965 | Protein ID | WP_131341011.1 |
| Coordinates | 2299958..2300374 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ89_RS10940 (NFJ89_10940) | 2296516..2296746 | - | 231 | WP_016153158.1 | DUF2554 family protein | - |
| NFJ89_RS10945 (NFJ89_10945) | 2296936..2297061 | - | 126 | WP_003020230.1 | DUF2474 domain-containing protein | - |
| NFJ89_RS10950 (NFJ89_10950) | 2297061..2298071 | - | 1011 | WP_016153157.1 | cytochrome d ubiquinol oxidase subunit II | - |
| NFJ89_RS10955 (NFJ89_10955) | 2298071..2299474 | - | 1404 | WP_047417372.1 | cytochrome ubiquinol oxidase subunit I | - |
| NFJ89_RS10960 (NFJ89_10960) | 2299738..2299926 | + | 189 | WP_049259794.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NFJ89_RS10965 (NFJ89_10965) | 2299958..2300374 | + | 417 | WP_131341011.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NFJ89_RS10970 (NFJ89_10970) | 2300467..2301876 | + | 1410 | WP_019076828.1 | PLP-dependent aminotransferase family protein | - |
| NFJ89_RS10975 (NFJ89_10975) | 2302206..2303351 | + | 1146 | WP_016153154.1 | ABC transporter substrate-binding protein | - |
| NFJ89_RS10980 (NFJ89_10980) | 2303368..2304384 | + | 1017 | WP_016156582.1 | ABC transporter ATP-binding protein | - |
| NFJ89_RS10985 (NFJ89_10985) | 2304385..2305329 | + | 945 | WP_016153152.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7102.16 Da Isoelectric Point: 11.5775
>T248753 WP_049259794.1 NZ_CP099379:2299738-2299926 [Citrobacter braakii]
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
Download Length: 189 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15034.31 Da Isoelectric Point: 4.7119
>AT248753 WP_131341011.1 NZ_CP099379:2299958-2300374 [Citrobacter braakii]
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGAEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGAEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|