Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4667986..4668602 | Replicon | chromosome |
Accession | NZ_CP099378 | ||
Organism | Citrobacter braakii strain RHB21-E1-C04 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NFK10_RS22355 | Protein ID | WP_016155182.1 |
Coordinates | 4667986..4668360 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | R8WIS4 |
Locus tag | NFK10_RS22360 | Protein ID | WP_016155181.1 |
Coordinates | 4668360..4668602 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK10_RS22340 (4665489) | 4665489..4666391 | + | 903 | WP_003028691.1 | formate dehydrogenase O subunit beta | - |
NFK10_RS22345 (4666388) | 4666388..4667023 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
NFK10_RS22350 (4667020) | 4667020..4667949 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
NFK10_RS22355 (4667986) | 4667986..4668360 | - | 375 | WP_016155182.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NFK10_RS22360 (4668360) | 4668360..4668602 | - | 243 | WP_016155181.1 | CopG family transcriptional regulator | Antitoxin |
NFK10_RS22365 (4668808) | 4668808..4669716 | + | 909 | Protein_4368 | alpha/beta hydrolase | - |
NFK10_RS22370 (4669781) | 4669781..4670023 | + | 243 | WP_016155179.1 | type II toxin-antitoxin system ParD family antitoxin | - |
NFK10_RS22375 (4670016) | 4670016..4670303 | + | 288 | WP_016157876.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
NFK10_RS22380 (4670309) | 4670309..4671250 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
NFK10_RS22385 (4671295) | 4671295..4671732 | - | 438 | WP_016157874.1 | D-aminoacyl-tRNA deacylase | - |
NFK10_RS22390 (4671729) | 4671729..4672601 | - | 873 | WP_019077938.1 | virulence factor BrkB family protein | - |
NFK10_RS22395 (4672595) | 4672595..4673194 | - | 600 | WP_016157873.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13678.84 Da Isoelectric Point: 8.5373
>T248751 WP_016155182.1 NZ_CP099378:c4668360-4667986 [Citrobacter braakii]
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|