Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-DnaT |
| Location | 4233044..4233563 | Replicon | chromosome |
| Accession | NZ_CP099378 | ||
| Organism | Citrobacter braakii strain RHB21-E1-C04 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NFK10_RS20365 | Protein ID | WP_016155559.1 |
| Coordinates | 4233044..4233325 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A0V9JX71 |
| Locus tag | NFK10_RS20370 | Protein ID | WP_016155558.1 |
| Coordinates | 4233315..4233563 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK10_RS20350 (4230048) | 4230048..4230512 | + | 465 | WP_016155562.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NFK10_RS20355 (4230531) | 4230531..4231052 | - | 522 | WP_016155561.1 | hypothetical protein | - |
| NFK10_RS20360 (4231052) | 4231052..4233016 | - | 1965 | WP_279278345.1 | type VI secretion system tip protein TssI/VgrG | - |
| NFK10_RS20365 (4233044) | 4233044..4233325 | - | 282 | WP_016155559.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NFK10_RS20370 (4233315) | 4233315..4233563 | - | 249 | WP_016155558.1 | hypothetical protein | Antitoxin |
| NFK10_RS20375 (4233661) | 4233661..4233789 | - | 129 | WP_016155557.1 | hypothetical protein | - |
| NFK10_RS20380 (4233858) | 4233858..4234331 | - | 474 | WP_016155556.1 | hypothetical protein | - |
| NFK10_RS20385 (4234374) | 4234374..4236875 | - | 2502 | WP_016155555.1 | type VI secretion system ATPase TssH | - |
| NFK10_RS20390 (4236866) | 4236866..4237813 | - | 948 | WP_016155554.1 | type VI secretion system baseplate subunit TssG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11004.76 Da Isoelectric Point: 10.4466
>T248750 WP_016155559.1 NZ_CP099378:c4233325-4233044 [Citrobacter braakii]
MTYNLEFLDVALKEWRKLSPTLREQFKKKLAERLENPHVPAARLSGKLHRYKIKLRSAGYRLVYQVEDEQVVVLVIAVGR
RDGDEVYHQANRR
MTYNLEFLDVALKEWRKLSPTLREQFKKKLAERLENPHVPAARLSGKLHRYKIKLRSAGYRLVYQVEDEQVVVLVIAVGR
RDGDEVYHQANRR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|