Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ypjF-yeeU/CbtA-CbeA |
Location | 4153235..4154046 | Replicon | chromosome |
Accession | NZ_CP099378 | ||
Organism | Citrobacter braakii strain RHB21-E1-C04 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | NFK10_RS20035 | Protein ID | WP_279278325.1 |
Coordinates | 4153235..4153618 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | NFK10_RS20040 | Protein ID | WP_279278326.1 |
Coordinates | 4153690..4154046 (-) | Length | 119 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK10_RS20010 (4150010) | 4150010..4150372 | + | 363 | WP_016155589.1 | endoribonuclease SymE | - |
NFK10_RS20015 (4150430) | 4150430..4150915 | - | 486 | WP_016151545.1 | type VI secretion system tube protein TssD | - |
NFK10_RS20020 (4150934) | 4150934..4151260 | - | 327 | WP_016155588.1 | DUF1493 family protein | - |
NFK10_RS20025 (4151254) | 4151254..4151703 | - | 450 | WP_003830103.1 | hypothetical protein | - |
NFK10_RS20030 (4151962) | 4151962..4152834 | + | 873 | WP_049268566.1 | HNH endonuclease | - |
NFK10_RS20035 (4153235) | 4153235..4153618 | - | 384 | WP_279278325.1 | TA system toxin CbtA family protein | Toxin |
NFK10_RS20040 (4153690) | 4153690..4154046 | - | 357 | WP_279278326.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NFK10_RS20045 (4154067) | 4154067..4154288 | - | 222 | WP_199953514.1 | DUF987 domain-containing protein | - |
NFK10_RS20050 (4154302) | 4154302..4154775 | - | 474 | WP_279278327.1 | DNA repair protein RadC | - |
NFK10_RS20055 (4154846) | 4154846..4155664 | - | 819 | WP_199953516.1 | DUF932 domain-containing protein | - |
NFK10_RS20060 (4155782) | 4155782..4156333 | - | 552 | WP_279278328.1 | DUF4234 domain-containing protein | - |
NFK10_RS20065 (4156396) | 4156396..4156824 | - | 429 | WP_279278329.1 | hypothetical protein | - |
NFK10_RS20070 (4156833) | 4156833..4157270 | - | 438 | WP_279278330.1 | hypothetical protein | - |
NFK10_RS20075 (4157406) | 4157406..4157558 | - | 153 | WP_167809833.1 | hypothetical protein | - |
NFK10_RS20080 (4157740) | 4157740..4158627 | - | 888 | WP_279278331.1 | 50S ribosome-binding GTPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4150934..4184297 | 33363 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14343.38 Da Isoelectric Point: 5.5607
>T248749 WP_279278325.1 NZ_CP099378:c4153618-4153235 [Citrobacter braakii]
MQTKLMTPLGAAHTCLTPIAIWQTLLTQLLGQHYGLQLHDTPFSDDDVIQSHIDAGITLVDALNFIVEKYELVRTDRSEF
TILERSPFITAVDILRARKVTDLSLRSGYRMISRITQGKGSDQENEQ
MQTKLMTPLGAAHTCLTPIAIWQTLLTQLLGQHYGLQLHDTPFSDDDVIQSHIDAGITLVDALNFIVEKYELVRTDRSEF
TILERSPFITAVDILRARKVTDLSLRSGYRMISRITQGKGSDQENEQ
Download Length: 384 bp
Antitoxin
Download Length: 119 a.a. Molecular weight: 13320.24 Da Isoelectric Point: 5.9559
>AT248749 WP_279278326.1 NZ_CP099378:c4154046-4153690 [Citrobacter braakii]
MSKKTLTMDDDATEPWWGLKCDTTSCFGSRLVQEGNRLHYLADRACLMGQFSEADLHHLDQAFPVLLKQIELMLTSGELN
PRYQHCVTLYAKGLTCEADTLGSCGYVYLAVYPTLHTR
MSKKTLTMDDDATEPWWGLKCDTTSCFGSRLVQEGNRLHYLADRACLMGQFSEADLHHLDQAFPVLLKQIELMLTSGELN
PRYQHCVTLYAKGLTCEADTLGSCGYVYLAVYPTLHTR
Download Length: 357 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|