Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4115130..4115706 | Replicon | chromosome |
Accession | NZ_CP099378 | ||
Organism | Citrobacter braakii strain RHB21-E1-C04 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | A0A8I0KMP7 |
Locus tag | NFK10_RS19840 | Protein ID | WP_016155613.1 |
Coordinates | 4115419..4115706 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A2I8S1U6 |
Locus tag | NFK10_RS19835 | Protein ID | WP_016155614.1 |
Coordinates | 4115130..4115432 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK10_RS19820 (4111632) | 4111632..4111826 | + | 195 | WP_003830038.1 | YbdD/YjiX family protein | - |
NFK10_RS19825 (4111839) | 4111839..4112795 | + | 957 | WP_016155616.1 | GTPase | - |
NFK10_RS19830 (4112982) | 4112982..4114829 | + | 1848 | WP_016155615.1 | 3'-5' exonuclease | - |
NFK10_RS19835 (4115130) | 4115130..4115432 | - | 303 | WP_016155614.1 | BrnA antitoxin family protein | Antitoxin |
NFK10_RS19840 (4115419) | 4115419..4115706 | - | 288 | WP_016155613.1 | BrnT family toxin | Toxin |
NFK10_RS19845 (4115941) | 4115941..4117107 | + | 1167 | WP_019078303.1 | restriction endonuclease | - |
NFK10_RS19850 (4117203) | 4117203..4117349 | + | 147 | Protein_3886 | type I restriction endonuclease subunit R | - |
NFK10_RS19855 (4117336) | 4117336..4117596 | + | 261 | Protein_3887 | endoribonuclease SymE | - |
NFK10_RS19860 (4117691) | 4117691..4118182 | - | 492 | WP_016151575.1 | type VI secretion system tube protein TssD | - |
NFK10_RS19865 (4118183) | 4118183..4118689 | - | 507 | WP_016155610.1 | hypothetical protein | - |
NFK10_RS19870 (4118689) | 4118689..4119120 | - | 432 | WP_225836832.1 | DUF2778 domain-containing protein | - |
NFK10_RS19875 (4119278) | 4119278..4119448 | - | 171 | Protein_3891 | hypothetical protein | - |
NFK10_RS19880 (4119454) | 4119454..4119908 | - | 455 | Protein_3892 | MarR family transcriptional regulator | - |
NFK10_RS19885 (4120057) | 4120057..4120221 | - | 165 | WP_016155606.1 | DUF1127 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11310.75 Da Isoelectric Point: 7.4687
>T248748 WP_016155613.1 NZ_CP099378:c4115706-4115419 [Citrobacter braakii]
MPMEFEWDANKAQSNLRKHGVRFEDAILVFDDPQHLSRQERYENGEYRWQTIGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHS
MPMEFEWDANKAQSNLRKHGVRFEDAILVFDDPQHLSRQERYENGEYRWQTIGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHS
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|