Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3575115..3575735 | Replicon | chromosome |
Accession | NZ_CP099378 | ||
Organism | Citrobacter braakii strain RHB21-E1-C04 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | NFK10_RS17395 | Protein ID | WP_002892050.1 |
Coordinates | 3575517..3575735 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | R8WZW8 |
Locus tag | NFK10_RS17390 | Protein ID | WP_003021733.1 |
Coordinates | 3575115..3575489 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK10_RS17380 (3570262) | 3570262..3571455 | + | 1194 | WP_016152074.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NFK10_RS17385 (3571478) | 3571478..3574627 | + | 3150 | WP_016152073.1 | efflux RND transporter permease AcrB | - |
NFK10_RS17390 (3575115) | 3575115..3575489 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
NFK10_RS17395 (3575517) | 3575517..3575735 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
NFK10_RS17400 (3575916) | 3575916..3576467 | + | 552 | WP_016155874.1 | maltose O-acetyltransferase | - |
NFK10_RS17405 (3576584) | 3576584..3577054 | + | 471 | WP_016152071.1 | YlaC family protein | - |
NFK10_RS17410 (3577133) | 3577133..3577273 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
NFK10_RS17415 (3577275) | 3577275..3577535 | - | 261 | WP_016152070.1 | type B 50S ribosomal protein L31 | - |
NFK10_RS17420 (3577724) | 3577724..3579277 | + | 1554 | WP_016155873.1 | EAL domain-containing protein | - |
NFK10_RS17425 (3579329) | 3579329..3579682 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
NFK10_RS17430 (3579747) | 3579747..3580376 | - | 630 | WP_016155872.1 | membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T248747 WP_002892050.1 NZ_CP099378:3575517-3575735 [Citrobacter braakii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT248747 WP_003021733.1 NZ_CP099378:3575115-3575489 [Citrobacter braakii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | R8WZW8 |