Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2327787..2328423 | Replicon | chromosome |
Accession | NZ_CP099378 | ||
Organism | Citrobacter braakii strain RHB21-E1-C04 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A2I8S6E9 |
Locus tag | NFK10_RS11230 | Protein ID | WP_049259794.1 |
Coordinates | 2327787..2327975 (+) | Length | 63 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NFK10_RS11235 | Protein ID | WP_131382557.1 |
Coordinates | 2328007..2328423 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK10_RS11210 (2324565) | 2324565..2324795 | - | 231 | WP_016156585.1 | DUF2554 family protein | - |
NFK10_RS11215 (2324985) | 2324985..2325110 | - | 126 | WP_003020230.1 | DUF2474 domain-containing protein | - |
NFK10_RS11220 (2325110) | 2325110..2326120 | - | 1011 | WP_016153157.1 | cytochrome d ubiquinol oxidase subunit II | - |
NFK10_RS11225 (2326120) | 2326120..2327523 | - | 1404 | WP_016153156.1 | cytochrome ubiquinol oxidase subunit I | - |
NFK10_RS11230 (2327787) | 2327787..2327975 | + | 189 | WP_049259794.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NFK10_RS11235 (2328007) | 2328007..2328423 | + | 417 | WP_131382557.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NFK10_RS11240 (2328516) | 2328516..2329925 | + | 1410 | WP_016156583.1 | PLP-dependent aminotransferase family protein | - |
NFK10_RS11245 (2330255) | 2330255..2331400 | + | 1146 | WP_016153154.1 | ABC transporter substrate-binding protein | - |
NFK10_RS11250 (2331417) | 2331417..2332433 | + | 1017 | WP_016156582.1 | ABC transporter ATP-binding protein | - |
NFK10_RS11255 (2332434) | 2332434..2333378 | + | 945 | WP_016153152.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7102.16 Da Isoelectric Point: 11.5775
>T248742 WP_049259794.1 NZ_CP099378:2327787-2327975 [Citrobacter braakii]
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
Download Length: 189 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15064.33 Da Isoelectric Point: 4.7119
>AT248742 WP_131382557.1 NZ_CP099378:2328007-2328423 [Citrobacter braakii]
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGTEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGTEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|