Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 820691..821345 | Replicon | chromosome |
Accession | NZ_CP099378 | ||
Organism | Citrobacter braakii strain RHB21-E1-C04 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | R8WN60 |
Locus tag | NFK10_RS04025 | Protein ID | WP_016154348.1 |
Coordinates | 820938..821345 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | R8WMJ6 |
Locus tag | NFK10_RS04020 | Protein ID | WP_016154349.1 |
Coordinates | 820691..820957 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK10_RS03995 (815904) | 815904..817337 | - | 1434 | WP_016154353.1 | 6-phospho-beta-glucosidase BglA | - |
NFK10_RS04000 (817458) | 817458..818186 | - | 729 | WP_003838265.1 | MurR/RpiR family transcriptional regulator | - |
NFK10_RS04005 (818239) | 818239..818550 | + | 312 | WP_016154352.1 | N(4)-acetylcytidine aminohydrolase | - |
NFK10_RS04010 (818714) | 818714..819373 | + | 660 | WP_016154351.1 | hemolysin III family protein | - |
NFK10_RS04015 (819453) | 819453..820433 | - | 981 | WP_016157415.1 | tRNA-modifying protein YgfZ | - |
NFK10_RS04020 (820691) | 820691..820957 | + | 267 | WP_016154349.1 | FAD assembly factor SdhE | Antitoxin |
NFK10_RS04025 (820938) | 820938..821345 | + | 408 | WP_016154348.1 | protein YgfX | Toxin |
NFK10_RS04030 (821446) | 821446..821967 | - | 522 | WP_016157414.1 | flavodoxin FldB | - |
NFK10_RS04035 (822081) | 822081..822977 | + | 897 | WP_016154346.1 | site-specific tyrosine recombinase XerD | - |
NFK10_RS04040 (823001) | 823001..823714 | + | 714 | WP_016154345.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFK10_RS04045 (823720) | 823720..825453 | + | 1734 | WP_016157413.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15850.66 Da Isoelectric Point: 11.2845
>T248741 WP_016154348.1 NZ_CP099378:820938-821345 [Citrobacter braakii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|