Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4071004..4071658 | Replicon | chromosome |
| Accession | NZ_CP099377 | ||
| Organism | Citrobacter braakii strain RHB23-SO-C01 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | R8WN60 |
| Locus tag | NFK19_RS19400 | Protein ID | WP_016154348.1 |
| Coordinates | 4071004..4071411 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | R8WMJ6 |
| Locus tag | NFK19_RS19405 | Protein ID | WP_016154349.1 |
| Coordinates | 4071392..4071658 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK19_RS19380 (4066896) | 4066896..4068629 | - | 1734 | WP_016157413.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| NFK19_RS19385 (4068635) | 4068635..4069348 | - | 714 | WP_279266595.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NFK19_RS19390 (4069372) | 4069372..4070268 | - | 897 | WP_016154346.1 | site-specific tyrosine recombinase XerD | - |
| NFK19_RS19395 (4070382) | 4070382..4070903 | + | 522 | WP_279266596.1 | flavodoxin FldB | - |
| NFK19_RS19400 (4071004) | 4071004..4071411 | - | 408 | WP_016154348.1 | protein YgfX | Toxin |
| NFK19_RS19405 (4071392) | 4071392..4071658 | - | 267 | WP_016154349.1 | FAD assembly factor SdhE | Antitoxin |
| NFK19_RS19410 (4071916) | 4071916..4072896 | + | 981 | WP_016154350.1 | tRNA-modifying protein YgfZ | - |
| NFK19_RS19415 (4072976) | 4072976..4073635 | - | 660 | WP_016154351.1 | hemolysin III family protein | - |
| NFK19_RS19420 (4073799) | 4073799..4074110 | - | 312 | WP_016154352.1 | N(4)-acetylcytidine aminohydrolase | - |
| NFK19_RS19425 (4074163) | 4074163..4074891 | + | 729 | WP_003838265.1 | MurR/RpiR family transcriptional regulator | - |
| NFK19_RS19430 (4075012) | 4075012..4076445 | + | 1434 | WP_016154353.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15850.66 Da Isoelectric Point: 11.2845
>T248737 WP_016154348.1 NZ_CP099377:c4071411-4071004 [Citrobacter braakii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|