Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 1937776..1938366 | Replicon | chromosome |
Accession | NZ_CP099377 | ||
Organism | Citrobacter braakii strain RHB23-SO-C01 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | NFK19_RS09135 | Protein ID | WP_049041157.1 |
Coordinates | 1938034..1938366 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | NFK19_RS09130 | Protein ID | WP_049041154.1 |
Coordinates | 1937776..1938033 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK19_RS09125 (1933265) | 1933265..1937164 | - | 3900 | WP_279266947.1 | hypothetical protein | - |
NFK19_RS09130 (1937776) | 1937776..1938033 | + | 258 | WP_049041154.1 | antitoxin | Antitoxin |
NFK19_RS09135 (1938034) | 1938034..1938366 | + | 333 | WP_049041157.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NFK19_RS09145 (1938614) | 1938614..1940101 | - | 1488 | WP_049040618.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
NFK19_RS09155 (1940499) | 1940499..1941761 | + | 1263 | WP_181545753.1 | integrase arm-type DNA-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11731.54 Da Isoelectric Point: 8.5572
>T248730 WP_049041157.1 NZ_CP099377:1938034-1938366 [Citrobacter braakii]
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGNFARAAGFTVSLDGVGTKTTGVIRCDQPRTI
DMGARNGKCLERIPEAVVNEVLARLEAILS
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGNFARAAGFTVSLDGVGTKTTGVIRCDQPRTI
DMGARNGKCLERIPEAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|