Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1255208..1255828 | Replicon | chromosome |
Accession | NZ_CP099377 | ||
Organism | Citrobacter braakii strain RHB23-SO-C01 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | NFK19_RS05930 | Protein ID | WP_002892050.1 |
Coordinates | 1255208..1255426 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A7L6U5G9 |
Locus tag | NFK19_RS05935 | Protein ID | WP_019076175.1 |
Coordinates | 1255454..1255828 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK19_RS05895 (1250567) | 1250567..1251196 | + | 630 | WP_049270150.1 | membrane protein | - |
NFK19_RS05900 (1251261) | 1251261..1251614 | + | 354 | WP_003831033.1 | DUF1428 family protein | - |
NFK19_RS05905 (1251666) | 1251666..1253219 | - | 1554 | WP_279266861.1 | EAL domain-containing protein | - |
NFK19_RS05910 (1253408) | 1253408..1253668 | + | 261 | WP_016152070.1 | type B 50S ribosomal protein L31 | - |
NFK19_RS05915 (1253670) | 1253670..1253810 | + | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
NFK19_RS05920 (1253889) | 1253889..1254359 | - | 471 | WP_016152071.1 | YlaC family protein | - |
NFK19_RS05925 (1254476) | 1254476..1255027 | - | 552 | WP_019076174.1 | maltose O-acetyltransferase | - |
NFK19_RS05930 (1255208) | 1255208..1255426 | - | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
NFK19_RS05935 (1255454) | 1255454..1255828 | - | 375 | WP_019076175.1 | Hha toxicity modulator TomB | Antitoxin |
NFK19_RS05940 (1256316) | 1256316..1259465 | - | 3150 | WP_016152073.1 | efflux RND transporter permease AcrB | - |
NFK19_RS05945 (1259488) | 1259488..1260681 | - | 1194 | WP_016152074.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T248729 WP_002892050.1 NZ_CP099377:c1255426-1255208 [Citrobacter braakii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14413.20 Da Isoelectric Point: 5.5653
>AT248729 WP_019076175.1 NZ_CP099377:c1255828-1255454 [Citrobacter braakii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7L6U5G9 |