Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4788236..4788852 Replicon chromosome
Accession NZ_CP099376
Organism Citrobacter braakii strain RHB23-SO-C04

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NFK21_RS22740 Protein ID WP_016155182.1
Coordinates 4788236..4788610 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID R8WIS4
Locus tag NFK21_RS22745 Protein ID WP_016155181.1
Coordinates 4788610..4788852 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK21_RS22725 (4785739) 4785739..4786641 + 903 WP_003028691.1 formate dehydrogenase O subunit beta -
NFK21_RS22730 (4786638) 4786638..4787273 + 636 WP_003028686.1 formate dehydrogenase cytochrome b556 subunit -
NFK21_RS22735 (4787270) 4787270..4788199 + 930 WP_003028685.1 formate dehydrogenase accessory protein FdhE -
NFK21_RS22740 (4788236) 4788236..4788610 - 375 WP_016155182.1 type II toxin-antitoxin system VapC family toxin Toxin
NFK21_RS22745 (4788610) 4788610..4788852 - 243 WP_016155181.1 CopG family transcriptional regulator Antitoxin
NFK21_RS22750 (4789058) 4789058..4789987 + 930 WP_137351792.1 alpha/beta hydrolase -
NFK21_RS22755 (4790072) 4790072..4790383 + 312 WP_019077936.1 type II toxin-antitoxin system HigB family toxin -
NFK21_RS22760 (4790380) 4790380..4790832 + 453 WP_141876133.1 helix-turn-helix domain-containing protein -
NFK21_RS22765 (4790850) 4790850..4791791 - 942 WP_003825286.1 fatty acid biosynthesis protein FabY -
NFK21_RS22770 (4791836) 4791836..4792273 - 438 WP_149382140.1 D-aminoacyl-tRNA deacylase -
NFK21_RS22775 (4792270) 4792270..4793142 - 873 WP_279266673.1 virulence factor BrkB family protein -
NFK21_RS22780 (4793136) 4793136..4793735 - 600 WP_279266674.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-113)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13678.84 Da        Isoelectric Point: 8.5373

>T248726 WP_016155182.1 NZ_CP099376:c4788610-4788236 [Citrobacter braakii]
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.72 Da        Isoelectric Point: 4.3331

>AT248726 WP_016155181.1 NZ_CP099376:c4788852-4788610 [Citrobacter braakii]
MMAGMDMGRILLDLSDEVIKRLDDLKVQRNLPRAELLREAVEQYLERQDQAETTISRALGLWQGCEEDGVDYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB R8WIS4

References