Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4071016..4071670 | Replicon | chromosome |
Accession | NZ_CP099376 | ||
Organism | Citrobacter braakii strain RHB23-SO-C04 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | R8WN60 |
Locus tag | NFK21_RS19395 | Protein ID | WP_016154348.1 |
Coordinates | 4071016..4071423 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | R8WMJ6 |
Locus tag | NFK21_RS19400 | Protein ID | WP_016154349.1 |
Coordinates | 4071404..4071670 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK21_RS19375 (4066908) | 4066908..4068641 | - | 1734 | WP_016157413.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NFK21_RS19380 (4068647) | 4068647..4069360 | - | 714 | WP_279266595.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFK21_RS19385 (4069384) | 4069384..4070280 | - | 897 | WP_016154346.1 | site-specific tyrosine recombinase XerD | - |
NFK21_RS19390 (4070394) | 4070394..4070915 | + | 522 | WP_279266596.1 | flavodoxin FldB | - |
NFK21_RS19395 (4071016) | 4071016..4071423 | - | 408 | WP_016154348.1 | protein YgfX | Toxin |
NFK21_RS19400 (4071404) | 4071404..4071670 | - | 267 | WP_016154349.1 | FAD assembly factor SdhE | Antitoxin |
NFK21_RS19405 (4071928) | 4071928..4072908 | + | 981 | WP_016154350.1 | tRNA-modifying protein YgfZ | - |
NFK21_RS19410 (4072988) | 4072988..4073647 | - | 660 | WP_016154351.1 | hemolysin III family protein | - |
NFK21_RS19415 (4073811) | 4073811..4074122 | - | 312 | WP_016154352.1 | N(4)-acetylcytidine aminohydrolase | - |
NFK21_RS19420 (4074175) | 4074175..4074903 | + | 729 | WP_003838265.1 | MurR/RpiR family transcriptional regulator | - |
NFK21_RS19425 (4075024) | 4075024..4076457 | + | 1434 | WP_016154353.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15850.66 Da Isoelectric Point: 11.2845
>T248725 WP_016154348.1 NZ_CP099376:c4071423-4071016 [Citrobacter braakii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|