Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2533926..2534562 | Replicon | chromosome |
Accession | NZ_CP099376 | ||
Organism | Citrobacter braakii strain RHB23-SO-C04 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | NFK21_RS12080 | Protein ID | WP_137379723.1 |
Coordinates | 2534374..2534562 (-) | Length | 63 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NFK21_RS12075 | Protein ID | WP_131341011.1 |
Coordinates | 2533926..2534342 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK21_RS12055 (2528971) | 2528971..2529915 | - | 945 | WP_016153152.1 | ABC transporter permease | - |
NFK21_RS12060 (2529916) | 2529916..2530932 | - | 1017 | WP_053389782.1 | ABC transporter ATP-binding protein | - |
NFK21_RS12065 (2530949) | 2530949..2532094 | - | 1146 | WP_075848180.1 | ABC transporter substrate-binding protein | - |
NFK21_RS12070 (2532424) | 2532424..2533833 | - | 1410 | WP_137379724.1 | PLP-dependent aminotransferase family protein | - |
NFK21_RS12075 (2533926) | 2533926..2534342 | - | 417 | WP_131341011.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NFK21_RS12080 (2534374) | 2534374..2534562 | - | 189 | WP_137379723.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NFK21_RS12085 (2534826) | 2534826..2536229 | + | 1404 | WP_016153156.1 | cytochrome ubiquinol oxidase subunit I | - |
NFK21_RS12090 (2536229) | 2536229..2537239 | + | 1011 | WP_016153157.1 | cytochrome d ubiquinol oxidase subunit II | - |
NFK21_RS12095 (2537239) | 2537239..2537364 | + | 126 | WP_003020230.1 | DUF2474 domain-containing protein | - |
NFK21_RS12100 (2537554) | 2537554..2537784 | + | 231 | WP_016153158.1 | DUF2554 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7175.25 Da Isoelectric Point: 11.8399
>T248724 WP_137379723.1 NZ_CP099376:c2534562-2534374 [Citrobacter braakii]
VKQSEFRRWLESQGVAITNGSNHLKLRYQGRRSVMPRHRGDEIKEALRKSILKQLGLQSSSI
VKQSEFRRWLESQGVAITNGSNHLKLRYQGRRSVMPRHRGDEIKEALRKSILKQLGLQSSSI
Download Length: 189 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15034.31 Da Isoelectric Point: 4.7119
>AT248724 WP_131341011.1 NZ_CP099376:c2534342-2533926 [Citrobacter braakii]
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGAEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGAEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|