Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4886310..4886926 | Replicon | chromosome |
Accession | NZ_CP099375 | ||
Organism | Citrobacter braakii strain RHB25-E4-C05 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NFK28_RS23445 | Protein ID | WP_053388922.1 |
Coordinates | 4886310..4886684 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | R8WIS4 |
Locus tag | NFK28_RS23450 | Protein ID | WP_016155181.1 |
Coordinates | 4886684..4886926 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK28_RS23430 (4883813) | 4883813..4884715 | + | 903 | WP_053388921.1 | formate dehydrogenase O subunit beta | - |
NFK28_RS23435 (4884712) | 4884712..4885347 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
NFK28_RS23440 (4885344) | 4885344..4886273 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
NFK28_RS23445 (4886310) | 4886310..4886684 | - | 375 | WP_053388922.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NFK28_RS23450 (4886684) | 4886684..4886926 | - | 243 | WP_016155181.1 | CopG family transcriptional regulator | Antitoxin |
NFK28_RS23455 (4887131) | 4887131..4888060 | + | 930 | WP_149330683.1 | alpha/beta hydrolase | - |
NFK28_RS23460 (4888145) | 4888145..4888453 | + | 309 | WP_053388923.1 | type II toxin-antitoxin system HigB family toxin | - |
NFK28_RS23465 (4888453) | 4888453..4888905 | + | 453 | WP_053388924.1 | helix-turn-helix domain-containing protein | - |
NFK28_RS23470 (4888923) | 4888923..4889864 | - | 942 | WP_053388925.1 | fatty acid biosynthesis protein FabY | - |
NFK28_RS23475 (4889909) | 4889909..4890346 | - | 438 | WP_003028671.1 | D-aminoacyl-tRNA deacylase | - |
NFK28_RS23480 (4890343) | 4890343..4891215 | - | 873 | WP_019077938.1 | virulence factor BrkB family protein | - |
NFK28_RS23485 (4891209) | 4891209..4891808 | - | 600 | WP_016157873.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13738.93 Da Isoelectric Point: 8.5373
>T248714 WP_053388922.1 NZ_CP099375:c4886684-4886310 [Citrobacter braakii]
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQEFRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQEFRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|