Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 4340728..4341431 | Replicon | chromosome |
| Accession | NZ_CP099375 | ||
| Organism | Citrobacter braakii strain RHB25-E4-C05 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | - |
| Locus tag | NFK28_RS20910 | Protein ID | WP_166465229.1 |
| Coordinates | 4340728..4341069 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | NFK28_RS20915 | Protein ID | WP_166465230.1 |
| Coordinates | 4341090..4341431 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK28_RS20880 (4336452) | 4336452..4336814 | + | 363 | WP_019078284.1 | endoribonuclease SymE | - |
| NFK28_RS20885 (4336877) | 4336877..4337362 | - | 486 | WP_016151545.1 | type VI secretion system tube protein TssD | - |
| NFK28_RS20890 (4337381) | 4337381..4337707 | - | 327 | WP_016155588.1 | DUF1493 family protein | - |
| NFK28_RS20895 (4337701) | 4337701..4338150 | - | 450 | WP_003830103.1 | hypothetical protein | - |
| NFK28_RS20900 (4338409) | 4338409..4339281 | + | 873 | WP_081000487.1 | HNH endonuclease | - |
| NFK28_RS20905 (4339462) | 4339462..4340469 | - | 1008 | WP_127675147.1 | restriction endonuclease | - |
| NFK28_RS20910 (4340728) | 4340728..4341069 | - | 342 | WP_166465229.1 | TA system toxin CbtA family protein | Toxin |
| NFK28_RS20915 (4341090) | 4341090..4341431 | - | 342 | WP_166465230.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NFK28_RS20920 (4341442) | 4341442..4341984 | - | 543 | WP_166465231.1 | DNA repair protein RadC | - |
| NFK28_RS20925 (4341997) | 4341997..4342440 | - | 444 | WP_047365977.1 | antirestriction protein | - |
| NFK28_RS20930 (4342471) | 4342471..4343292 | - | 822 | WP_166465232.1 | DUF932 domain-containing protein | - |
| NFK28_RS20935 (4343377) | 4343377..4343892 | - | 516 | WP_166465233.1 | DUF4234 domain-containing protein | - |
| NFK28_RS20940 (4343954) | 4343954..4344421 | - | 468 | WP_166465234.1 | hypothetical protein | - |
| NFK28_RS20945 (4344517) | 4344517..4344918 | - | 402 | WP_166465235.1 | hypothetical protein | - |
| NFK28_RS20950 (4345121) | 4345121..4346008 | - | 888 | WP_166465236.1 | 50S ribosome-binding GTPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4337701..4350604 | 12903 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12633.59 Da Isoelectric Point: 5.6618
>T248713 WP_166465229.1 NZ_CP099375:c4341069-4340728 [Citrobacter braakii]
MKTLPATTPQAATLCLSPVAVWQMLLACLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNLLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKINRISAAQ
MKTLPATTPQAATLCLSPVAVWQMLLACLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNLLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKINRISAAQ
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|