Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 4295447..4296023 | Replicon | chromosome |
| Accession | NZ_CP099375 | ||
| Organism | Citrobacter braakii strain RHB25-E4-C05 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | - |
| Locus tag | NFK28_RS20720 | Protein ID | WP_053389309.1 |
| Coordinates | 4295736..4296023 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A7L6U766 |
| Locus tag | NFK28_RS20715 | Protein ID | WP_046275900.1 |
| Coordinates | 4295447..4295749 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK28_RS20700 (4291942) | 4291942..4292136 | + | 195 | WP_003830038.1 | YbdD/YjiX family protein | - |
| NFK28_RS20705 (4292149) | 4292149..4293105 | + | 957 | WP_053389311.1 | GTPase | - |
| NFK28_RS20710 (4293292) | 4293292..4295139 | + | 1848 | WP_279278152.1 | NERD domain-containing protein/DEAD/DEAH box helicase | - |
| NFK28_RS20715 (4295447) | 4295447..4295749 | - | 303 | WP_046275900.1 | BrnA antitoxin family protein | Antitoxin |
| NFK28_RS20720 (4295736) | 4295736..4296023 | - | 288 | WP_053389309.1 | BrnT family toxin | Toxin |
| NFK28_RS20725 (4296254) | 4296254..4297420 | + | 1167 | WP_019078303.1 | restriction endonuclease | - |
| NFK28_RS20730 (4297516) | 4297516..4299945 | + | 2430 | WP_053389308.1 | DEAD/DEAH box helicase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11307.71 Da Isoelectric Point: 7.5237
>T248712 WP_053389309.1 NZ_CP099375:c4296023-4295736 [Citrobacter braakii]
MPMEFEWDANKAQSNHRKHGIRFEDAILVFDDPQHLSRQDRYENGEYRWQTIGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERSRYEHS
MPMEFEWDANKAQSNHRKHGIRFEDAILVFDDPQHLSRQDRYENGEYRWQTIGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERSRYEHS
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|