Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3717982..3718602 | Replicon | chromosome |
Accession | NZ_CP099375 | ||
Organism | Citrobacter braakii strain RHB25-E4-C05 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | NFK28_RS18045 | Protein ID | WP_002892050.1 |
Coordinates | 3718384..3718602 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A7L6U5G9 |
Locus tag | NFK28_RS18040 | Protein ID | WP_019076175.1 |
Coordinates | 3717982..3718356 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK28_RS18030 (3713129) | 3713129..3714322 | + | 1194 | WP_053389373.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NFK28_RS18035 (3714345) | 3714345..3717494 | + | 3150 | WP_016152073.1 | efflux RND transporter permease AcrB | - |
NFK28_RS18040 (3717982) | 3717982..3718356 | + | 375 | WP_019076175.1 | Hha toxicity modulator TomB | Antitoxin |
NFK28_RS18045 (3718384) | 3718384..3718602 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
NFK28_RS18050 (3718783) | 3718783..3719334 | + | 552 | WP_016152072.1 | maltose O-acetyltransferase | - |
NFK28_RS18055 (3719451) | 3719451..3719921 | + | 471 | WP_016152071.1 | YlaC family protein | - |
NFK28_RS18060 (3720000) | 3720000..3720140 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
NFK28_RS18065 (3720142) | 3720142..3720402 | - | 261 | WP_016152070.1 | type B 50S ribosomal protein L31 | - |
NFK28_RS18070 (3720591) | 3720591..3722144 | + | 1554 | WP_053388979.1 | EAL domain-containing protein | - |
NFK28_RS18075 (3722196) | 3722196..3722549 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
NFK28_RS18080 (3722614) | 3722614..3723243 | - | 630 | WP_049270150.1 | membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T248711 WP_002892050.1 NZ_CP099375:3718384-3718602 [Citrobacter braakii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14413.20 Da Isoelectric Point: 5.5653
>AT248711 WP_019076175.1 NZ_CP099375:3717982-3718356 [Citrobacter braakii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7L6U5G9 |