Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2525931..2526567 | Replicon | chromosome |
| Accession | NZ_CP099375 | ||
| Organism | Citrobacter braakii strain RHB25-E4-C05 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2I8S6E9 |
| Locus tag | NFK28_RS12395 | Protein ID | WP_049259794.1 |
| Coordinates | 2525931..2526119 (+) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NFK28_RS12400 | Protein ID | WP_131382557.1 |
| Coordinates | 2526151..2526567 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK28_RS12375 (2522709) | 2522709..2522939 | - | 231 | WP_016153158.1 | DUF2554 family protein | - |
| NFK28_RS12380 (2523129) | 2523129..2523254 | - | 126 | WP_003020230.1 | DUF2474 domain-containing protein | - |
| NFK28_RS12385 (2523254) | 2523254..2524264 | - | 1011 | WP_016153157.1 | cytochrome d ubiquinol oxidase subunit II | - |
| NFK28_RS12390 (2524264) | 2524264..2525667 | - | 1404 | WP_016153156.1 | cytochrome ubiquinol oxidase subunit I | - |
| NFK28_RS12395 (2525931) | 2525931..2526119 | + | 189 | WP_049259794.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NFK28_RS12400 (2526151) | 2526151..2526567 | + | 417 | WP_131382557.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NFK28_RS12405 (2526660) | 2526660..2528069 | + | 1410 | WP_019076828.1 | PLP-dependent aminotransferase family protein | - |
| NFK28_RS12410 (2528399) | 2528399..2529544 | + | 1146 | WP_016153154.1 | ABC transporter substrate-binding protein | - |
| NFK28_RS12415 (2529561) | 2529561..2530577 | + | 1017 | WP_053389782.1 | ABC transporter ATP-binding protein | - |
| NFK28_RS12420 (2530578) | 2530578..2531522 | + | 945 | WP_016153152.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7102.16 Da Isoelectric Point: 11.5775
>T248705 WP_049259794.1 NZ_CP099375:2525931-2526119 [Citrobacter braakii]
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
Download Length: 189 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15064.33 Da Isoelectric Point: 4.7119
>AT248705 WP_131382557.1 NZ_CP099375:2526151-2526567 [Citrobacter braakii]
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGTEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGTEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|