Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 1025191..1025852 | Replicon | chromosome |
Accession | NZ_CP099375 | ||
Organism | Citrobacter braakii strain RHB25-E4-C05 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | S3IMJ6 |
Locus tag | NFK28_RS05085 | Protein ID | WP_000698542.1 |
Coordinates | 1025529..1025852 (+) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | S3J179 |
Locus tag | NFK28_RS05080 | Protein ID | WP_000065326.1 |
Coordinates | 1025191..1025508 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK28_RS05035 (1020331) | 1020331..1021155 | + | 825 | WP_000197385.1 | DUF932 domain-containing protein | - |
NFK28_RS05040 (1021364) | 1021364..1022074 | + | 711 | WP_024198336.1 | hypothetical protein | - |
NFK28_RS05045 (1022100) | 1022100..1022636 | + | 537 | WP_000219797.1 | DUF4339 domain-containing protein | - |
NFK28_RS05050 (1022678) | 1022678..1023115 | + | 438 | WP_024198335.1 | hypothetical protein | - |
NFK28_RS05055 (1023182) | 1023182..1023592 | + | 411 | WP_000912997.1 | hypothetical protein | - |
NFK28_RS05060 (1023670) | 1023670..1023906 | + | 237 | WP_000004273.1 | DUF905 domain-containing protein | - |
NFK28_RS05065 (1023992) | 1023992..1024450 | + | 459 | WP_016538084.1 | antirestriction protein | - |
NFK28_RS05070 (1024466) | 1024466..1024942 | + | 477 | WP_000811694.1 | RadC family protein | - |
NFK28_RS05075 (1024951) | 1024951..1025172 | + | 222 | WP_000691995.1 | DUF987 domain-containing protein | - |
NFK28_RS05080 (1025191) | 1025191..1025508 | + | 318 | WP_000065326.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NFK28_RS05085 (1025529) | 1025529..1025852 | + | 324 | WP_000698542.1 | TA system toxin CbtA family protein | Toxin |
NFK28_RS05090 (1027304) | 1027304..1027831 | + | 528 | WP_046274927.1 | Vi polysaccharide biosynthesis protein TviA | - |
NFK28_RS05095 (1028089) | 1028089..1029366 | + | 1278 | WP_016157409.1 | Vi polysaccharide biosynthesis UDP-N-acetylglucosamine C-6 dehydrogenase TviB | - |
NFK28_RS05100 (1029369) | 1029369..1030409 | + | 1041 | WP_053389486.1 | Vi polysaccharide biosynthesis UDP-N-acetylglucosaminuronic acid C-4 epimerase TviC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | tviB / tviC | 988776..1030409 | 41633 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12350.38 Da Isoelectric Point: 8.9789
>T248704 WP_000698542.1 NZ_CP099375:1025529-1025852 [Citrobacter braakii]
MKILPATISRAAKPCLPPVAVWQLLLTRLLEKHYGLTLNDTPFSDETVIKEHFDAGITLANAINFLVEKYELVRIDRRGF
SWQEQTPYLTNIDIMRARRDLGLLNRN
MKILPATISRAAKPCLPPVAVWQLLLTRLLEKHYGLTLNDTPFSDETVIKEHFDAGITLANAINFLVEKYELVRIDRRGF
SWQEQTPYLTNIDIMRARRDLGLLNRN
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|