Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 979294..979948 | Replicon | chromosome |
Accession | NZ_CP099375 | ||
Organism | Citrobacter braakii strain RHB25-E4-C05 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | R8WN60 |
Locus tag | NFK28_RS04795 | Protein ID | WP_016154348.1 |
Coordinates | 979541..979948 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | R8WMJ6 |
Locus tag | NFK28_RS04790 | Protein ID | WP_016154349.1 |
Coordinates | 979294..979560 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK28_RS04765 (974507) | 974507..975940 | - | 1434 | WP_053389494.1 | 6-phospho-beta-glucosidase BglA | - |
NFK28_RS04770 (976061) | 976061..976789 | - | 729 | WP_003838265.1 | MurR/RpiR family transcriptional regulator | - |
NFK28_RS04775 (976842) | 976842..977153 | + | 312 | WP_016154352.1 | N(4)-acetylcytidine aminohydrolase | - |
NFK28_RS04780 (977317) | 977317..977976 | + | 660 | WP_016154351.1 | hemolysin III family protein | - |
NFK28_RS04785 (978056) | 978056..979036 | - | 981 | WP_053389491.1 | tRNA-modifying protein YgfZ | - |
NFK28_RS04790 (979294) | 979294..979560 | + | 267 | WP_016154349.1 | FAD assembly factor SdhE | Antitoxin |
NFK28_RS04795 (979541) | 979541..979948 | + | 408 | WP_016154348.1 | protein YgfX | Toxin |
NFK28_RS04800 (980049) | 980049..980570 | - | 522 | WP_016154347.1 | flavodoxin FldB | - |
NFK28_RS04805 (980684) | 980684..981580 | + | 897 | WP_046274931.1 | site-specific tyrosine recombinase XerD | - |
NFK28_RS04810 (981604) | 981604..982317 | + | 714 | WP_016154345.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFK28_RS04815 (982323) | 982323..984056 | + | 1734 | WP_053389488.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15850.66 Da Isoelectric Point: 11.2845
>T248703 WP_016154348.1 NZ_CP099375:979541-979948 [Citrobacter braakii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|