Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 840034..840819 | Replicon | chromosome |
Accession | NZ_CP099375 | ||
Organism | Citrobacter braakii strain RHB25-E4-C05 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | NFK28_RS04125 | Protein ID | WP_040063377.1 |
Coordinates | 840034..840411 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | NFK28_RS04130 | Protein ID | WP_038633768.1 |
Coordinates | 840460..840819 (-) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK28_RS04095 (835388) | 835388..835855 | - | 468 | WP_047358704.1 | DUF6392 family protein | - |
NFK28_RS04100 (835855) | 835855..836430 | - | 576 | WP_081000505.1 | S-type pyocin domain-containing protein | - |
NFK28_RS04105 (836391) | 836391..837632 | - | 1242 | WP_053390097.1 | S-type pyocin domain-containing protein | - |
NFK28_RS04110 (838393) | 838393..839241 | - | 849 | WP_040229927.1 | DUF4942 domain-containing protein | - |
NFK28_RS04115 (839322) | 839322..839516 | - | 195 | WP_047661001.1 | DUF957 domain-containing protein | - |
NFK28_RS04120 (839546) | 839546..840037 | - | 492 | WP_040063379.1 | DUF5983 family protein | - |
NFK28_RS04125 (840034) | 840034..840411 | - | 378 | WP_040063377.1 | TA system toxin CbtA family protein | Toxin |
NFK28_RS04130 (840460) | 840460..840819 | - | 360 | WP_038633768.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NFK28_RS04135 (840842) | 840842..841063 | - | 222 | WP_038633763.1 | DUF987 domain-containing protein | - |
NFK28_RS04140 (841075) | 841075..841560 | - | 486 | WP_038642868.1 | DNA repair protein RadC | - |
NFK28_RS04145 (841613) | 841613..842008 | - | 396 | WP_052322945.1 | antirestriction protein | - |
NFK28_RS04150 (842086) | 842086..842349 | - | 264 | WP_038633754.1 | hypothetical protein | - |
NFK28_RS04155 (842349) | 842349..843167 | - | 819 | WP_001234374.1 | DUF932 domain-containing protein | - |
NFK28_RS04160 (843283) | 843283..843533 | - | 251 | Protein_818 | DUF905 family protein | - |
NFK28_RS04165 (843724) | 843724..844191 | - | 468 | WP_000727137.1 | hypothetical protein | - |
NFK28_RS04170 (844288) | 844288..844689 | - | 402 | WP_047660999.1 | hypothetical protein | - |
NFK28_RS04175 (844895) | 844895..845782 | - | 888 | WP_047661008.1 | 50S ribosome-binding GTPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 807028..855396 | 48368 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14020.87 Da Isoelectric Point: 6.8604
>T248702 WP_040063377.1 NZ_CP099375:c840411-840034 [Citrobacter braakii]
MQTQPVSPAREASPRLSPVEIWQRLLSHLLDHHYGLALNDTPFGNDDVIQEHIDAGISLCDAVNFIVEKYDLVRTDRYGS
STTEQSPLISSIDILRARKACGLMTRNGYRAVTDITTGKYSKMTR
MQTQPVSPAREASPRLSPVEIWQRLLSHLLDHHYGLALNDTPFGNDDVIQEHIDAGISLCDAVNFIVEKYDLVRTDRYGS
STTEQSPLISSIDILRARKACGLMTRNGYRAVTDITTGKYSKMTR
Download Length: 378 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13318.30 Da Isoelectric Point: 7.4424
>AT248702 WP_038633768.1 NZ_CP099375:c840819-840460 [Citrobacter braakii]
MLNKTLPANHHISEPWWGLKRNITPCFGARLVQEGNRLHYLADRASITGTFTDADLRHLDQAFPVLLKQMELMLVSGELS
PRHQHCVTLYAKGLTCEADSLGSHGYIYIAIYPTPSVTS
MLNKTLPANHHISEPWWGLKRNITPCFGARLVQEGNRLHYLADRASITGTFTDADLRHLDQAFPVLLKQMELMLVSGELS
PRHQHCVTLYAKGLTCEADSLGSHGYIYIAIYPTPSVTS
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|