Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4823428..4824044 Replicon chromosome
Accession NZ_CP099374
Organism Citrobacter braakii strain RHB25-SO-C06

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NFK30_RS23125 Protein ID WP_109017832.1
Coordinates 4823428..4823802 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID R8WIS4
Locus tag NFK30_RS23130 Protein ID WP_016155181.1
Coordinates 4823802..4824044 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK30_RS23110 (4820931) 4820931..4821833 + 903 WP_003028691.1 formate dehydrogenase O subunit beta -
NFK30_RS23115 (4821830) 4821830..4822465 + 636 WP_003028686.1 formate dehydrogenase cytochrome b556 subunit -
NFK30_RS23120 (4822462) 4822462..4823391 + 930 WP_003028685.1 formate dehydrogenase accessory protein FdhE -
NFK30_RS23125 (4823428) 4823428..4823802 - 375 WP_109017832.1 type II toxin-antitoxin system VapC family toxin Toxin
NFK30_RS23130 (4823802) 4823802..4824044 - 243 WP_016155181.1 CopG family transcriptional regulator Antitoxin
NFK30_RS23135 (4824250) 4824250..4825158 + 909 WP_109017833.1 alpha/beta hydrolase -
NFK30_RS23140 (4825223) 4825223..4825465 + 243 WP_016155179.1 type II toxin-antitoxin system ParD family antitoxin -
NFK30_RS23145 (4825458) 4825458..4825745 + 288 WP_109017834.1 type II toxin-antitoxin system RelE/ParE family toxin -
NFK30_RS23150 (4825751) 4825751..4826692 - 942 WP_003825286.1 fatty acid biosynthesis protein FabY -
NFK30_RS23155 (4826737) 4826737..4827174 - 438 WP_109017835.1 D-aminoacyl-tRNA deacylase -
NFK30_RS23160 (4827171) 4827171..4828043 - 873 WP_109017836.1 virulence factor BrkB family protein -
NFK30_RS23165 (4828037) 4828037..4828636 - 600 WP_016155174.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-113)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13712.85 Da        Isoelectric Point: 8.5373

>T248701 WP_109017832.1 NZ_CP099374:c4823802-4823428 [Citrobacter braakii]
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKFPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.72 Da        Isoelectric Point: 4.3331

>AT248701 WP_016155181.1 NZ_CP099374:c4824044-4823802 [Citrobacter braakii]
MMAGMDMGRILLDLSDEVIKRLDDLKVQRNLPRAELLREAVEQYLERQDQAETTISRALGLWQGCEEDGVDYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB R8WIS4

References