Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-DnaT |
| Location | 4400205..4400724 | Replicon | chromosome |
| Accession | NZ_CP099374 | ||
| Organism | Citrobacter braakii strain RHB25-SO-C06 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A8I0G602 |
| Locus tag | NFK30_RS21175 | Protein ID | WP_047414720.1 |
| Coordinates | 4400205..4400486 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A0V9JX71 |
| Locus tag | NFK30_RS21180 | Protein ID | WP_016155558.1 |
| Coordinates | 4400476..4400724 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK30_RS21160 (4397210) | 4397210..4397674 | + | 465 | WP_016155562.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NFK30_RS21165 (4397693) | 4397693..4398214 | - | 522 | WP_109017767.1 | hypothetical protein | - |
| NFK30_RS21170 (4398214) | 4398214..4400178 | - | 1965 | WP_109017766.1 | type VI secretion system tip protein TssI/VgrG | - |
| NFK30_RS21175 (4400205) | 4400205..4400486 | - | 282 | WP_047414720.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NFK30_RS21180 (4400476) | 4400476..4400724 | - | 249 | WP_016155558.1 | hypothetical protein | Antitoxin |
| NFK30_RS21185 (4400821) | 4400821..4400949 | - | 129 | WP_016155557.1 | hypothetical protein | - |
| NFK30_RS21190 (4401018) | 4401018..4401491 | - | 474 | WP_016155556.1 | hypothetical protein | - |
| NFK30_RS21195 (4401534) | 4401534..4404035 | - | 2502 | WP_109018352.1 | type VI secretion system ATPase TssH | - |
| NFK30_RS21200 (4404026) | 4404026..4404973 | - | 948 | WP_109018353.1 | type VI secretion system baseplate subunit TssG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10974.73 Da Isoelectric Point: 10.4466
>T248700 WP_047414720.1 NZ_CP099374:c4400486-4400205 [Citrobacter braakii]
MTYNLEFLDVALKEWRKLSPALREQFKKKLAERLENPHVPAARLSGKLHRYKIKLRSAGYRLVYQVEDEQVVVLVIAVGR
RDGDEVYHQANRR
MTYNLEFLDVALKEWRKLSPALREQFKKKLAERLENPHVPAARLSGKLHRYKIKLRSAGYRLVYQVEDEQVVVLVIAVGR
RDGDEVYHQANRR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|