Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) shpAB/BrnT-BrnA
Location 4292461..4293037 Replicon chromosome
Accession NZ_CP099374
Organism Citrobacter braakii strain RHB25-SO-C06

Toxin (Protein)


Gene name shpA Uniprot ID A0A8I0KMP7
Locus tag NFK30_RS20690 Protein ID WP_016155613.1
Coordinates 4292750..4293037 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name shpB Uniprot ID A0A2I8S1U6
Locus tag NFK30_RS20685 Protein ID WP_016155614.1
Coordinates 4292461..4292763 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK30_RS20670 (4288956) 4288956..4289150 + 195 WP_003830038.1 YbdD/YjiX family protein -
NFK30_RS20675 (4289163) 4289163..4290119 + 957 WP_016155616.1 GTPase -
NFK30_RS20680 (4290306) 4290306..4292153 + 1848 WP_109017584.1 3'-5' exonuclease -
NFK30_RS20685 (4292461) 4292461..4292763 - 303 WP_016155614.1 BrnA antitoxin family protein Antitoxin
NFK30_RS20690 (4292750) 4292750..4293037 - 288 WP_016155613.1 BrnT family toxin Toxin
NFK30_RS20695 (4293272) 4293272..4294438 + 1167 WP_019078303.1 restriction endonuclease -
NFK30_RS20700 (4294534) 4294534..4294689 + 156 Protein_4053 type I restriction endonuclease subunit R -
NFK30_RS20705 (4294670) 4294670..4294977 + 308 Protein_4054 SymE family type I addiction module toxin -
NFK30_RS20710 (4295072) 4295072..4295563 - 492 WP_016151575.1 type VI secretion system tube protein TssD -
NFK30_RS20715 (4295564) 4295564..4296070 - 507 WP_016151574.1 hypothetical protein -
NFK30_RS20720 (4296070) 4296070..4296501 - 432 WP_223870143.1 DUF2778 domain-containing protein -
NFK30_RS20725 (4296659) 4296659..4296829 - 171 Protein_4058 hypothetical protein -
NFK30_RS20730 (4296835) 4296835..4297299 - 465 WP_159137116.1 MarR family transcriptional regulator -
NFK30_RS20735 (4297448) 4297448..4297612 - 165 WP_064484482.1 DUF1127 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(7-88)

Antitoxin

BrnA antitoxin of type II toxin-antitoxin system

(42-93)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11310.75 Da        Isoelectric Point: 7.4687

>T248699 WP_016155613.1 NZ_CP099374:c4293037-4292750 [Citrobacter braakii]
MPMEFEWDANKAQSNLRKHGVRFEDAILVFDDPQHLSRQERYENGEYRWQTIGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHS

Download         Length: 288 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11466.12 Da        Isoelectric Point: 10.1293

>AT248699 WP_016155614.1 NZ_CP099374:c4292763-4292461 [Citrobacter braakii]
MSIVKHKRGSVSALSAQHEAELKALANKPDDDIDYSDIPVTEDKQWSEAIRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A2I8S1U6

References