Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 3942245..3942771 | Replicon | chromosome |
Accession | NZ_CP099374 | ||
Organism | Citrobacter braakii strain RHB25-SO-C06 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | NFK30_RS19070 | Protein ID | WP_000323025.1 |
Coordinates | 3942245..3942532 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | J5W3H0 |
Locus tag | NFK30_RS19075 | Protein ID | WP_004196370.1 |
Coordinates | 3942532..3942771 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK30_RS19020 (3938249) | 3938249..3938950 | + | 702 | WP_001548933.1 | WYL domain-containing protein | - |
NFK30_RS19025 (3938991) | 3938991..3939227 | + | 237 | WP_001144031.1 | protein YpjK | - |
NFK30_RS19030 (3939227) | 3939227..3939670 | + | 444 | WP_001547764.1 | lipoprotein YafY | - |
NFK30_RS19035 (3939694) | 3939694..3940161 | + | 468 | WP_001547765.1 | protein YkfB | - |
NFK30_RS19040 (3940238) | 3940238..3940477 | + | 240 | WP_000194654.1 | DUF905 family protein | - |
NFK30_RS19045 (3940575) | 3940575..3941033 | + | 459 | WP_128317712.1 | antirestriction protein | - |
NFK30_RS19050 (3941049) | 3941049..3941525 | + | 477 | WP_000811693.1 | RadC family protein | - |
NFK30_RS19055 (3941534) | 3941534..3941755 | + | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
NFK30_RS19060 (3941774) | 3941774..3942091 | + | 318 | WP_000070396.1 | type IV toxin-antitoxin system antitoxin YafW | - |
NFK30_RS19065 (3942112) | 3942112..3942361 | + | 250 | Protein_3736 | TA system toxin CbtA family protein | - |
NFK30_RS19070 (3942245) | 3942245..3942532 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
NFK30_RS19075 (3942532) | 3942532..3942771 | - | 240 | WP_004196370.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
NFK30_RS19080 (3942796) | 3942796..3942900 | + | 105 | Protein_3739 | protein YdfV | - |
NFK30_RS19085 (3943034) | 3943034..3943957 | - | 924 | WP_000167917.1 | cation diffusion facilitator family transporter | - |
NFK30_RS19090 (3944157) | 3944157..3944729 | - | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
NFK30_RS19095 (3945205) | 3945205..3946443 | - | 1239 | WP_061283191.1 | IS110-like element ISEsa2 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T248698 WP_000323025.1 NZ_CP099374:c3942532-3942245 [Citrobacter braakii]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|