Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3716746..3717366 | Replicon | chromosome |
Accession | NZ_CP099374 | ||
Organism | Citrobacter braakii strain RHB25-SO-C06 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | NFK30_RS18005 | Protein ID | WP_002892050.1 |
Coordinates | 3717148..3717366 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | R8WZW8 |
Locus tag | NFK30_RS18000 | Protein ID | WP_003021733.1 |
Coordinates | 3716746..3717120 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK30_RS17990 (3711893) | 3711893..3713086 | + | 1194 | WP_016152074.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NFK30_RS17995 (3713109) | 3713109..3716258 | + | 3150 | WP_016152073.1 | efflux RND transporter permease AcrB | - |
NFK30_RS18000 (3716746) | 3716746..3717120 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
NFK30_RS18005 (3717148) | 3717148..3717366 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
NFK30_RS18010 (3717547) | 3717547..3718098 | + | 552 | WP_103283555.1 | maltose O-acetyltransferase | - |
NFK30_RS18015 (3718215) | 3718215..3718685 | + | 471 | WP_016152071.1 | YlaC family protein | - |
NFK30_RS18020 (3718764) | 3718764..3718904 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
NFK30_RS18025 (3718906) | 3718906..3719166 | - | 261 | WP_016152070.1 | type B 50S ribosomal protein L31 | - |
NFK30_RS18030 (3719354) | 3719354..3720907 | + | 1554 | WP_109018125.1 | EAL domain-containing protein | - |
NFK30_RS18035 (3720959) | 3720959..3721312 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
NFK30_RS18040 (3721377) | 3721377..3722006 | - | 630 | WP_016155872.1 | membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T248697 WP_002892050.1 NZ_CP099374:3717148-3717366 [Citrobacter braakii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT248697 WP_003021733.1 NZ_CP099374:3716746-3717120 [Citrobacter braakii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | R8WZW8 |