Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 3012639..3013229 | Replicon | chromosome |
Accession | NZ_CP099374 | ||
Organism | Citrobacter braakii strain RHB25-SO-C06 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A8I0G229 |
Locus tag | NFK30_RS14655 | Protein ID | WP_049270508.1 |
Coordinates | 3012639..3012971 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A8I0KQR6 |
Locus tag | NFK30_RS14660 | Protein ID | WP_049270509.1 |
Coordinates | 3012972..3013229 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK30_RS14630 (3007675) | 3007675..3008034 | - | 360 | WP_016156204.1 | purine nucleoside phosphoramidase | - |
NFK30_RS14635 (3008383) | 3008383..3010569 | + | 2187 | WP_109017717.1 | ferric-rhodotorulic acid/ferric-coprogen receptor FhuE | - |
NFK30_RS14645 (3010904) | 3010904..3012391 | + | 1488 | WP_049040618.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
NFK30_RS14655 (3012639) | 3012639..3012971 | - | 333 | WP_049270508.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NFK30_RS14660 (3012972) | 3012972..3013229 | - | 258 | WP_049270509.1 | antitoxin | Antitoxin |
NFK30_RS14665 (3013841) | 3013841..3017740 | + | 3900 | WP_109017714.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11784.58 Da Isoelectric Point: 10.2965
>T248696 WP_049270508.1 NZ_CP099374:c3012971-3012639 [Citrobacter braakii]
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGNFARAAGFTVSLDGVGTKTTGVIRCDQPRTI
DMGARNGKRLERIPEAVVNEVLARLEAILS
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGNFARAAGFTVSLDGVGTKTTGVIRCDQPRTI
DMGARNGKRLERIPEAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|