Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2452848..2453484 | Replicon | chromosome |
| Accession | NZ_CP099374 | ||
| Organism | Citrobacter braakii strain RHB25-SO-C06 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2I8S6E9 |
| Locus tag | NFK30_RS11855 | Protein ID | WP_049259794.1 |
| Coordinates | 2452848..2453036 (+) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NFK30_RS11860 | Protein ID | WP_131341011.1 |
| Coordinates | 2453068..2453484 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK30_RS11835 (2449626) | 2449626..2449856 | - | 231 | WP_016156585.1 | DUF2554 family protein | - |
| NFK30_RS11840 (2450046) | 2450046..2450171 | - | 126 | WP_003020230.1 | DUF2474 domain-containing protein | - |
| NFK30_RS11845 (2450171) | 2450171..2451181 | - | 1011 | WP_016153157.1 | cytochrome d ubiquinol oxidase subunit II | - |
| NFK30_RS11850 (2451181) | 2451181..2452584 | - | 1404 | WP_047417372.1 | cytochrome ubiquinol oxidase subunit I | - |
| NFK30_RS11855 (2452848) | 2452848..2453036 | + | 189 | WP_049259794.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NFK30_RS11860 (2453068) | 2453068..2453484 | + | 417 | WP_131341011.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NFK30_RS11865 (2453577) | 2453577..2454986 | + | 1410 | WP_019076828.1 | PLP-dependent aminotransferase family protein | - |
| NFK30_RS11870 (2455316) | 2455316..2456461 | + | 1146 | WP_016153154.1 | ABC transporter substrate-binding protein | - |
| NFK30_RS11875 (2456478) | 2456478..2457494 | + | 1017 | WP_016156582.1 | ABC transporter ATP-binding protein | - |
| NFK30_RS11880 (2457495) | 2457495..2458439 | + | 945 | WP_016153152.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7102.16 Da Isoelectric Point: 11.5775
>T248691 WP_049259794.1 NZ_CP099374:2452848-2453036 [Citrobacter braakii]
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
Download Length: 189 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15034.31 Da Isoelectric Point: 4.7119
>AT248691 WP_131341011.1 NZ_CP099374:2453068-2453484 [Citrobacter braakii]
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGAEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGAEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|