Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 868767..869421 | Replicon | chromosome |
Accession | NZ_CP099374 | ||
Organism | Citrobacter braakii strain RHB25-SO-C06 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | R8WN60 |
Locus tag | NFK30_RS04210 | Protein ID | WP_016154348.1 |
Coordinates | 869014..869421 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | R8WMJ6 |
Locus tag | NFK30_RS04205 | Protein ID | WP_016154349.1 |
Coordinates | 868767..869033 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK30_RS04180 (863980) | 863980..865413 | - | 1434 | WP_109017253.1 | 6-phospho-beta-glucosidase BglA | - |
NFK30_RS04185 (865534) | 865534..866262 | - | 729 | WP_003838265.1 | MurR/RpiR family transcriptional regulator | - |
NFK30_RS04190 (866315) | 866315..866626 | + | 312 | WP_016154352.1 | N(4)-acetylcytidine aminohydrolase | - |
NFK30_RS04195 (866790) | 866790..867449 | + | 660 | WP_016154351.1 | hemolysin III family protein | - |
NFK30_RS04200 (867529) | 867529..868509 | - | 981 | WP_094168631.1 | tRNA-modifying protein YgfZ | - |
NFK30_RS04205 (868767) | 868767..869033 | + | 267 | WP_016154349.1 | FAD assembly factor SdhE | Antitoxin |
NFK30_RS04210 (869014) | 869014..869421 | + | 408 | WP_016154348.1 | protein YgfX | Toxin |
NFK30_RS04215 (869522) | 869522..870043 | - | 522 | WP_016154347.1 | flavodoxin FldB | - |
NFK30_RS04220 (870157) | 870157..871053 | + | 897 | WP_016154346.1 | site-specific tyrosine recombinase XerD | - |
NFK30_RS04225 (871077) | 871077..871790 | + | 714 | WP_016154345.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFK30_RS04230 (871796) | 871796..873529 | + | 1734 | WP_109017254.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15850.66 Da Isoelectric Point: 11.2845
>T248690 WP_016154348.1 NZ_CP099374:869014-869421 [Citrobacter braakii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|