Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 4817730..4818265 | Replicon | chromosome |
Accession | NZ_CP099373 | ||
Organism | Citrobacter portucalensis strain RHB38-SO-C05 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NFK58_RS23210 | Protein ID | WP_085049650.1 |
Coordinates | 4817978..4818265 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | D4BKM9 |
Locus tag | NFK58_RS23205 | Protein ID | WP_006688247.1 |
Coordinates | 4817730..4817981 (+) | Length | 84 a.a. |
Genomic Context
Location: 4813207..4813965 (759 bp)
Type: Others
Protein ID: WP_123269099.1
Type: Others
Protein ID: WP_123269099.1
Location: 4814087..4814773 (687 bp)
Type: Others
Protein ID: WP_137382890.1
Type: Others
Protein ID: WP_137382890.1
Location: 4814770..4815906 (1137 bp)
Type: Others
Protein ID: WP_126957331.1
Type: Others
Protein ID: WP_126957331.1
Location: 4815909..4816463 (555 bp)
Type: Others
Protein ID: WP_079938996.1
Type: Others
Protein ID: WP_079938996.1
Location: 4816450..4816884 (435 bp)
Type: Others
Protein ID: WP_123269102.1
Type: Others
Protein ID: WP_123269102.1
Location: 4816893..4817651 (759 bp)
Type: Others
Protein ID: WP_191227901.1
Type: Others
Protein ID: WP_191227901.1
Location: 4817730..4817981 (252 bp)
Type: Antitoxin
Protein ID: WP_006688247.1
Type: Antitoxin
Protein ID: WP_006688247.1
Location: 4817978..4818265 (288 bp)
Type: Toxin
Protein ID: WP_085049650.1
Type: Toxin
Protein ID: WP_085049650.1
Location: 4818262..4818591 (330 bp)
Type: Others
Protein ID: WP_137361135.1
Type: Others
Protein ID: WP_137361135.1
Location: 4818660..4819292 (633 bp)
Type: Others
Protein ID: WP_123269105.1
Type: Others
Protein ID: WP_123269105.1
Location: 4819468..4821741 (2274 bp)
Type: Others
Protein ID: WP_123269106.1
Type: Others
Protein ID: WP_123269106.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK58_RS23175 (NFK58_23195) | 4813207..4813965 | + | 759 | WP_123269099.1 | phosphonate C-P lyase system protein PhnK | - |
NFK58_RS23180 (NFK58_23200) | 4814087..4814773 | + | 687 | WP_137382890.1 | phosphonate C-P lyase system protein PhnL | - |
NFK58_RS23185 (NFK58_23205) | 4814770..4815906 | + | 1137 | WP_126957331.1 | alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase | - |
NFK58_RS23190 (NFK58_23210) | 4815909..4816463 | + | 555 | WP_079938996.1 | ribose 1,5-bisphosphokinase | - |
NFK58_RS23195 (NFK58_23215) | 4816450..4816884 | + | 435 | WP_123269102.1 | aminoalkylphosphonate N-acetyltransferase | - |
NFK58_RS23200 (NFK58_23220) | 4816893..4817651 | + | 759 | WP_191227901.1 | phosphonate metabolism protein PhnP | - |
NFK58_RS23205 (NFK58_23225) | 4817730..4817981 | + | 252 | WP_006688247.1 | plasmid stabilization protein | Antitoxin |
NFK58_RS23210 (NFK58_23230) | 4817978..4818265 | + | 288 | WP_085049650.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFK58_RS23215 (NFK58_23235) | 4818262..4818591 | - | 330 | WP_137361135.1 | DDRRRQL repeat protein YjdP | - |
NFK58_RS23220 (NFK58_23240) | 4818660..4819292 | - | 633 | WP_123269105.1 | GNAT family N-acetyltransferase | - |
NFK58_RS23225 (NFK58_23245) | 4819468..4821741 | - | 2274 | WP_123269106.1 | hybrid sensor histidine kinase/response regulator | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11089.04 Da Isoelectric Point: 10.3527
>T248688 WP_085049650.1 NZ_CP099373:4817978-4818265 [Citrobacter portucalensis]
MSYTVKFREDALKEWQKLDKAIQQQFAKKLKKCCENPHVPSAKLRGIKDCYKIKLRTSGFRLVYQVIDDTLVIAVVAVGK
RERSEVYNLASERLR
MSYTVKFREDALKEWQKLDKAIQQQFAKKLKKCCENPHVPSAKLRGIKDCYKIKLRTSGFRLVYQVIDDTLVIAVVAVGK
RERSEVYNLASERLR
Download Length: 288 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7X1BT32 |