Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4767574..4768377 | Replicon | chromosome |
| Accession | NZ_CP099373 | ||
| Organism | Citrobacter portucalensis strain RHB38-SO-C05 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A6N6JYU3 |
| Locus tag | NFK58_RS22975 | Protein ID | WP_024156451.1 |
| Coordinates | 4767997..4768377 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | NFK58_RS22970 | Protein ID | WP_149692527.1 |
| Coordinates | 4767574..4767939 (+) | Length | 122 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK58_RS22930 (NFK58_22950) | 4762647..4763534 | + | 888 | WP_191225903.1 | 50S ribosome-binding GTPase | - |
| NFK58_RS22935 (NFK58_22955) | 4763740..4764141 | + | 402 | WP_149692533.1 | hypothetical protein | - |
| NFK58_RS22940 (NFK58_22960) | 4764238..4764705 | + | 468 | WP_149692532.1 | hypothetical protein | - |
| NFK58_RS22945 (NFK58_22965) | 4764896..4765147 | + | 252 | WP_149692531.1 | DUF905 family protein | - |
| NFK58_RS22950 (NFK58_22970) | 4765265..4766083 | + | 819 | WP_149692530.1 | DUF932 domain-containing protein | - |
| NFK58_RS22955 (NFK58_22975) | 4766343..4766825 | + | 483 | WP_149692529.1 | antirestriction protein | - |
| NFK58_RS22960 (NFK58_22980) | 4766838..4767317 | + | 480 | WP_024156448.1 | DNA repair protein RadC | - |
| NFK58_RS22965 (NFK58_22985) | 4767331..4767552 | + | 222 | WP_149692528.1 | DUF987 domain-containing protein | - |
| NFK58_RS22970 (NFK58_22990) | 4767574..4767939 | + | 366 | WP_149692527.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NFK58_RS22975 (NFK58_22995) | 4767997..4768377 | + | 381 | WP_024156451.1 | TA system toxin CbtA family protein | Toxin |
| NFK58_RS22980 (NFK58_23000) | 4768374..4768865 | + | 492 | WP_149692526.1 | DUF5983 family protein | - |
| NFK58_RS22985 (NFK58_23005) | 4768895..4769091 | + | 197 | Protein_4509 | hypothetical protein | - |
| NFK58_RS22990 (NFK58_23010) | 4769174..4770022 | + | 849 | WP_149692525.1 | DUF4942 domain-containing protein | - |
| NFK58_RS22995 (NFK58_23015) | 4770503..4770697 | + | 195 | WP_123268534.1 | hypothetical protein | - |
| NFK58_RS23000 (NFK58_23020) | 4770780..4772441 | + | 1662 | WP_123268533.1 | fatty acid--CoA ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14263.44 Da Isoelectric Point: 10.0919
>T248687 WP_024156451.1 NZ_CP099373:4767997-4768377 [Citrobacter portucalensis]
MQTLSAIPKRKAPSRPTPVEIWQQLLTYLLKRHYGLSLSDTQFSDEEIITQYIDAGISLSDALNFLVEKSELVRIDRPGF
SIKHQSPFIGVIDILRARRATGLMQRNGYKRITLLIAGNAAQEQHS
MQTLSAIPKRKAPSRPTPVEIWQQLLTYLLKRHYGLSLSDTQFSDEEIITQYIDAGISLSDALNFLVEKSELVRIDRPGF
SIKHQSPFIGVIDILRARRATGLMQRNGYKRITLLIAGNAAQEQHS
Download Length: 381 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13458.29 Da Isoelectric Point: 6.2044
>AT248687 WP_149692527.1 NZ_CP099373:4767574-4767939 [Citrobacter portucalensis]
MSNQLPPVNHDVSEPWWGLKPGITPCFGARLVQEGNRLHYLADRASIASVFSDADLRHLDQAFPVLLKQLELMLVSGELN
PRHQHCVTLYAKGLTCEADSLGSHGYIYTAIYPTPDDSITR
MSNQLPPVNHDVSEPWWGLKPGITPCFGARLVQEGNRLHYLADRASIASVFSDADLRHLDQAFPVLLKQLELMLVSGELN
PRHQHCVTLYAKGLTCEADSLGSHGYIYTAIYPTPDDSITR
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|