Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4621030..4621546 | Replicon | chromosome |
Accession | NZ_CP099373 | ||
Organism | Citrobacter portucalensis strain RHB38-SO-C05 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A6H3ATC4 |
Locus tag | NFK58_RS22175 | Protein ID | WP_048227188.1 |
Coordinates | 4621030..4621314 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A6H3AWC7 |
Locus tag | NFK58_RS22180 | Protein ID | WP_003830370.1 |
Coordinates | 4621304..4621546 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK58_RS22160 (NFK58_22180) | 4616241..4617893 | + | 1653 | WP_123268582.1 | alpha,alpha-phosphotrehalase | - |
NFK58_RS22165 (NFK58_22185) | 4618303..4620441 | + | 2139 | WP_003025782.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NFK58_RS22170 (NFK58_22190) | 4620562..4621026 | + | 465 | WP_048227187.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NFK58_RS22175 (NFK58_22195) | 4621030..4621314 | - | 285 | WP_048227188.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFK58_RS22180 (NFK58_22200) | 4621304..4621546 | - | 243 | WP_003830370.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NFK58_RS22185 (NFK58_22205) | 4621624..4623537 | - | 1914 | WP_191227861.1 | BglG family transcription antiterminator | - |
NFK58_RS22190 (NFK58_22210) | 4623559..4624299 | - | 741 | WP_191227862.1 | KDGP aldolase family protein | - |
NFK58_RS22195 (NFK58_22215) | 4624296..4625414 | - | 1119 | WP_128316769.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
NFK58_RS22200 (NFK58_22220) | 4625398..4626531 | - | 1134 | WP_123268580.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10918.71 Da Isoelectric Point: 10.0482
>T248686 WP_048227188.1 NZ_CP099373:c4621314-4621030 [Citrobacter portucalensis]
MTYELEFDPRALKEWHKLGDTVKTQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVVVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKTQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVVVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6H3ATC4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6H3AWC7 |