Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3890912..3891532 | Replicon | chromosome |
Accession | NZ_CP099373 | ||
Organism | Citrobacter portucalensis strain RHB38-SO-C05 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | NFK58_RS18750 | Protein ID | WP_002892050.1 |
Coordinates | 3891314..3891532 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | R8WZW8 |
Locus tag | NFK58_RS18745 | Protein ID | WP_003021733.1 |
Coordinates | 3890912..3891286 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK58_RS18735 (NFK58_18755) | 3886059..3887252 | + | 1194 | WP_279267828.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NFK58_RS18740 (NFK58_18760) | 3887275..3890424 | + | 3150 | WP_063941319.1 | efflux RND transporter permease AcrB | - |
NFK58_RS18745 (NFK58_18765) | 3890912..3891286 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
NFK58_RS18750 (NFK58_18770) | 3891314..3891532 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
NFK58_RS18755 (NFK58_18775) | 3891714..3892265 | + | 552 | WP_123268449.1 | maltose O-acetyltransferase | - |
NFK58_RS18760 (NFK58_18780) | 3892382..3892852 | + | 471 | WP_020996574.1 | YlaC family protein | - |
NFK58_RS18765 (NFK58_18785) | 3892931..3893071 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
NFK58_RS18770 (NFK58_18790) | 3893073..3893333 | - | 261 | WP_079938360.1 | type B 50S ribosomal protein L31 | - |
NFK58_RS18775 (NFK58_18795) | 3893522..3895075 | + | 1554 | WP_191227645.1 | EAL domain-containing protein | - |
NFK58_RS18780 (NFK58_18800) | 3895127..3895480 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
NFK58_RS18785 (NFK58_18805) | 3895545..3896174 | - | 630 | WP_123268450.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T248684 WP_002892050.1 NZ_CP099373:3891314-3891532 [Citrobacter portucalensis]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT248684 WP_003021733.1 NZ_CP099373:3890912-3891286 [Citrobacter portucalensis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | R8WZW8 |