Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2678041..2678777 | Replicon | chromosome |
Accession | NZ_CP099373 | ||
Organism | Citrobacter portucalensis strain RHB38-SO-C05 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | NFK58_RS12740 | Protein ID | WP_123267182.1 |
Coordinates | 2678295..2678777 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | NFK58_RS12735 | Protein ID | WP_191227292.1 |
Coordinates | 2678041..2678307 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK58_RS12715 (NFK58_12740) | 2673085..2674272 | + | 1188 | WP_191227289.1 | outer membrane protein transport protein | - |
NFK58_RS12720 (NFK58_12745) | 2674512..2675141 | + | 630 | WP_079937883.1 | winged helix-turn-helix transcriptional regulator | - |
NFK58_RS12725 (NFK58_12750) | 2675263..2675649 | - | 387 | WP_191227290.1 | hypothetical protein | - |
NFK58_RS12730 (NFK58_12755) | 2675904..2677886 | + | 1983 | WP_275396633.1 | alkyl sulfatase dimerization domain-containing protein | - |
NFK58_RS12735 (NFK58_12760) | 2678041..2678307 | + | 267 | WP_191227292.1 | DUF1778 domain-containing protein | Antitoxin |
NFK58_RS12740 (NFK58_12765) | 2678295..2678777 | + | 483 | WP_123267182.1 | GNAT family N-acetyltransferase | Toxin |
NFK58_RS12745 (NFK58_12770) | 2679064..2679606 | + | 543 | WP_279267723.1 | hypothetical protein | - |
NFK58_RS12750 (NFK58_12775) | 2679591..2679836 | + | 246 | WP_279267724.1 | DUF3850 domain-containing protein | - |
NFK58_RS12755 (NFK58_12780) | 2679833..2680066 | + | 234 | WP_279267725.1 | hypothetical protein | - |
NFK58_RS12760 (NFK58_12785) | 2680074..2680301 | + | 228 | WP_279267726.1 | hypothetical protein | - |
NFK58_RS12765 (NFK58_12790) | 2680314..2680607 | + | 294 | WP_279267727.1 | hypothetical protein | - |
NFK58_RS12770 (NFK58_12795) | 2680600..2681310 | + | 711 | WP_279267728.1 | hypothetical protein | - |
NFK58_RS12775 (NFK58_12800) | 2681379..2681645 | + | 267 | WP_279267729.1 | helix-turn-helix transcriptional regulator | - |
NFK58_RS12780 (NFK58_12805) | 2681632..2681979 | + | 348 | WP_279267730.1 | hypothetical protein | - |
NFK58_RS12785 (NFK58_12810) | 2681976..2682857 | + | 882 | WP_279267731.1 | integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2674512..2715180 | 40668 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17711.56 Da Isoelectric Point: 10.1381
>T248683 WP_123267182.1 NZ_CP099373:2678295-2678777 [Citrobacter portucalensis]
VGFVTAPEPLTHIHQLAEFVSGEIVLDDWLKQKGLKNQALGAARTFVVCKTNTRQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSVRRKGLGADLLHDAVLRCYKVAENIGVRAVMVHALTDEAKRFYLHHGFKASQLQERTLFLRLS
VGFVTAPEPLTHIHQLAEFVSGEIVLDDWLKQKGLKNQALGAARTFVVCKTNTRQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSVRRKGLGADLLHDAVLRCYKVAENIGVRAVMVHALTDEAKRFYLHHGFKASQLQERTLFLRLS
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|