Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 1337489..1338147 | Replicon | chromosome |
Accession | NZ_CP099373 | ||
Organism | Citrobacter portucalensis strain RHB38-SO-C05 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | A0A806ZJD4 |
Locus tag | NFK58_RS06425 | Protein ID | WP_071883340.1 |
Coordinates | 1337489..1337809 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A806NTI2 |
Locus tag | NFK58_RS06430 | Protein ID | WP_043082396.1 |
Coordinates | 1337830..1338147 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK58_RS06395 (NFK58_06425) | 1332817..1333707 | + | 891 | WP_123268140.1 | myo-inosose-2 dehydratase | - |
NFK58_RS06400 (NFK58_06430) | 1333717..1334535 | + | 819 | WP_191228300.1 | 5-deoxy-glucuronate isomerase | - |
NFK58_RS06405 (NFK58_06435) | 1334731..1335087 | - | 357 | WP_003826111.1 | hypothetical protein | - |
NFK58_RS06410 (NFK58_06440) | 1335984..1336184 | - | 201 | WP_079939236.1 | DUF4926 domain-containing protein | - |
NFK58_RS06415 (NFK58_06445) | 1336195..1336905 | - | 711 | Protein_1257 | hypothetical protein | - |
NFK58_RS06420 (NFK58_06450) | 1336999..1337124 | - | 126 | Protein_1258 | integrase | - |
NFK58_RS06425 (NFK58_06455) | 1337489..1337809 | - | 321 | WP_071883340.1 | TA system toxin CbtA family protein | Toxin |
NFK58_RS06430 (NFK58_06460) | 1337830..1338147 | - | 318 | WP_043082396.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NFK58_RS06435 (NFK58_06465) | 1338166..1338387 | - | 222 | WP_000691995.1 | DUF987 domain-containing protein | - |
NFK58_RS06440 (NFK58_06470) | 1338396..1338872 | - | 477 | WP_043082397.1 | RadC family protein | - |
NFK58_RS06445 (NFK58_06475) | 1338888..1339346 | - | 459 | WP_043082398.1 | antirestriction protein | - |
NFK58_RS06450 (NFK58_06480) | 1339427..1339663 | - | 237 | WP_071883341.1 | DUF905 domain-containing protein | - |
NFK58_RS06455 (NFK58_06485) | 1339741..1340151 | - | 411 | WP_043082399.1 | hypothetical protein | - |
NFK58_RS06460 (NFK58_06490) | 1340241..1340855 | - | 615 | WP_043082400.1 | hypothetical protein | - |
NFK58_RS06465 (NFK58_06495) | 1340852..1341556 | - | 705 | WP_043082401.1 | WYL domain-containing protein | - |
NFK58_RS06470 (NFK58_06500) | 1341758..1342591 | - | 834 | WP_279267912.1 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1336195..1362270 | 26075 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12032.98 Da Isoelectric Point: 7.1339
>T248677 WP_071883340.1 NZ_CP099373:c1337809-1337489 [Citrobacter portucalensis]
MKTLPATTLRAAKPCPSPVIVWQTLLSCLLDQHYGLTLNDTPFSDETVIKEHIDAGISLADAVNFLVEKYELVRIDRKGF
SWQEQSPFITAVDILKARRAMREMRT
MKTLPATTLRAAKPCPSPVIVWQTLLSCLLDQHYGLTLNDTPFSDETVIKEHIDAGISLADAVNFLVEKYELVRIDRKGF
SWQEQSPFITAVDILKARRAMREMRT
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A806ZJD4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A806NTI2 |