Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 997705..998359 | Replicon | chromosome |
| Accession | NZ_CP099373 | ||
| Organism | Citrobacter portucalensis strain RHB38-SO-C05 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | NFK58_RS04925 | Protein ID | WP_123267957.1 |
| Coordinates | 997952..998359 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A7W3EV23 |
| Locus tag | NFK58_RS04920 | Protein ID | WP_016150945.1 |
| Coordinates | 997705..997971 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK58_RS04895 (NFK58_04925) | 992860..994293 | - | 1434 | WP_191228206.1 | 6-phospho-beta-glucosidase BglA | - |
| NFK58_RS04900 (NFK58_04930) | 994414..995142 | - | 729 | WP_123268157.1 | MurR/RpiR family transcriptional regulator | - |
| NFK58_RS04905 (NFK58_04935) | 995195..995506 | + | 312 | WP_191228207.1 | N(4)-acetylcytidine aminohydrolase | - |
| NFK58_RS04910 (NFK58_04940) | 995670..996323 | + | 654 | WP_003825509.1 | hemolysin III family protein | - |
| NFK58_RS04915 (NFK58_04945) | 996464..997447 | - | 984 | WP_123267955.1 | tRNA-modifying protein YgfZ | - |
| NFK58_RS04920 (NFK58_04950) | 997705..997971 | + | 267 | WP_016150945.1 | FAD assembly factor SdhE | Antitoxin |
| NFK58_RS04925 (NFK58_04955) | 997952..998359 | + | 408 | WP_123267957.1 | protein YgfX | Toxin |
| NFK58_RS04930 (NFK58_04960) | 998461..998982 | - | 522 | WP_003026933.1 | flavodoxin FldB | - |
| NFK58_RS04935 (NFK58_04965) | 999096..999992 | + | 897 | WP_003825519.1 | site-specific tyrosine recombinase XerD | - |
| NFK58_RS04940 (NFK58_04970) | 1000016..1000729 | + | 714 | WP_003825520.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NFK58_RS04945 (NFK58_04975) | 1000735..1002468 | + | 1734 | WP_079938629.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15863.72 Da Isoelectric Point: 11.0795
>T248676 WP_123267957.1 NZ_CP099373:997952-998359 [Citrobacter portucalensis]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLHLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQG
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLHLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|