Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 304083..304669 | Replicon | chromosome |
| Accession | NZ_CP099373 | ||
| Organism | Citrobacter portucalensis strain RHB38-SO-C05 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | NFK58_RS01435 | Protein ID | WP_123268817.1 |
| Coordinates | 304301..304669 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | - |
| Locus tag | NFK58_RS01430 | Protein ID | WP_079938140.1 |
| Coordinates | 304083..304304 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK58_RS01405 (NFK58_01405) | 299912..300838 | + | 927 | WP_079938142.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| NFK58_RS01410 (NFK58_01410) | 300835..302112 | + | 1278 | WP_048215381.1 | branched chain amino acid ABC transporter permease LivM | - |
| NFK58_RS01415 (NFK58_01415) | 302109..302876 | + | 768 | WP_003023438.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| NFK58_RS01420 (NFK58_01420) | 302894..303607 | + | 714 | WP_003827581.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| NFK58_RS01425 (NFK58_01425) | 303708..303989 | + | 282 | WP_123268818.1 | hypothetical protein | - |
| NFK58_RS01430 (NFK58_01430) | 304083..304304 | + | 222 | WP_079938140.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NFK58_RS01435 (NFK58_01435) | 304301..304669 | + | 369 | WP_123268817.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NFK58_RS01440 (NFK58_01440) | 304927..306243 | + | 1317 | WP_123268816.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| NFK58_RS01445 (NFK58_01445) | 306354..307241 | + | 888 | WP_038634974.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| NFK58_RS01450 (NFK58_01450) | 307238..308083 | + | 846 | WP_003023450.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| NFK58_RS01455 (NFK58_01455) | 308086..309156 | + | 1071 | WP_191228052.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 300835..309896 | 9061 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13469.74 Da Isoelectric Point: 6.7249
>T248675 WP_123268817.1 NZ_CP099373:304301-304669 [Citrobacter portucalensis]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIALPANPDFVAMTVEAAAGQLTLEQIASRLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIALPANPDFVAMTVEAAAGQLTLEQIASRLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|