Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3882565..3883185 | Replicon | chromosome |
Accession | NZ_CP099370 | ||
Organism | Citrobacter portucalensis strain RHB40-E3-C01 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | NFK62_RS19385 | Protein ID | WP_002892050.1 |
Coordinates | 3882967..3883185 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | R8WZW8 |
Locus tag | NFK62_RS19380 | Protein ID | WP_003021733.1 |
Coordinates | 3882565..3882939 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK62_RS19370 (3877710) | 3877710..3878903 | + | 1194 | WP_003831044.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NFK62_RS19375 (3878926) | 3878926..3882075 | + | 3150 | WP_126319003.1 | efflux RND transporter permease AcrB | - |
NFK62_RS19380 (3882565) | 3882565..3882939 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
NFK62_RS19385 (3882967) | 3882967..3883185 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
NFK62_RS19390 (3883367) | 3883367..3883918 | + | 552 | WP_191219543.1 | maltose O-acetyltransferase | - |
NFK62_RS19395 (3884035) | 3884035..3884505 | + | 471 | WP_020996574.1 | YlaC family protein | - |
NFK62_RS19400 (3884584) | 3884584..3884724 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
NFK62_RS19405 (3884726) | 3884726..3884986 | - | 261 | WP_008783961.1 | type B 50S ribosomal protein L31 | - |
NFK62_RS19410 (3885175) | 3885175..3886728 | + | 1554 | WP_279275117.1 | EAL domain-containing protein | - |
NFK62_RS19415 (3886780) | 3886780..3887133 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
NFK62_RS19420 (3887198) | 3887198..3887827 | - | 630 | WP_279275118.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T248672 WP_002892050.1 NZ_CP099370:3882967-3883185 [Citrobacter portucalensis]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT248672 WP_003021733.1 NZ_CP099370:3882565-3882939 [Citrobacter portucalensis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | R8WZW8 |